WB (Western Blot)
(WB Suggested Anti-SIGIRR Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Rabbit SIGIRR Polyclonal Antibody | anti-SIGIRR antibody
SIGIRR antibody - C-terminal region
Gene Names
SIGIRR; TIR8; IL-1R8
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
SIGIRR, Antibody; SIGIRR antibody - C-terminal region; anti-SIGIRR antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYSARTDFYCLVSKDDM
Sequence Length
224
Applicable Applications for anti-SIGIRR antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SIGIRR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-SIGIRR Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
WB (Western Blot)
(WB Suggested Anti-SIGIRR Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
WB (Western Blot)
(Host: RabbitTarget Name: SIGIRRSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: SIGIRRSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
IHC (Immunohistochemistry)
(Liver)
IHC (Immunohistochemistry)
(Liver)
Related Product Information for anti-SIGIRR antibody
This is a rabbit polyclonal antibody against SIGIRR. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SIGIRR acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. It attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through a TIR-TIR domain interaction with TLR4. Through its extracellular domain it interferes with the heterodimerization of Il1R1 and IL1RAP.
Target Description: SIGIRR acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. It attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through a TIR-TIR domain interaction with TLR4. Through its extracellular domain it interferes with the heterodimerization of Il1R1 and IL1RAP.
Product Categories/Family for anti-SIGIRR antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
SIGIRR
NCBI Official Synonym Full Names
single Ig and TIR domain containing
NCBI Official Symbol
SIGIRR
NCBI Official Synonym Symbols
TIR8; IL-1R8
NCBI Protein Information
single Ig IL-1-related receptor
UniProt Protein Name
Single Ig IL-1-related receptor
UniProt Gene Name
SIGIRR
UniProt Synonym Gene Names
TIR8
UniProt Entry Name
SIGIR_HUMAN
Similar Products
Product Notes
The SIGIRR sigirr (Catalog #AAA200020) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SIGIRR antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SIGIRR can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SIGIRR sigirr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PVFGEPSAPP HTSGVSLGES RSSEVDVSDL GSRNYSARTD FYCLVSKDDM. It is sometimes possible for the material contained within the vial of "SIGIRR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.