Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.93kD).)

Mouse anti-Human AK3 Monoclonal Antibody | anti-AK3 antibody

AK3 (GTP:AMP Phosphotransferase, Mitochondrial, Adenylate Kinase 3, AK 3, Adenylate Kinase 3 alpha-like 1, AK3L1, AK6, AKL3L) (FITC)

Gene Names
AK3; AK6; FIX; AK3L1; AKL3L; AKL3L1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AK3; Monoclonal Antibody; AK3 (GTP:AMP Phosphotransferase; Mitochondrial; Adenylate Kinase 3; AK 3; Adenylate Kinase 3 alpha-like 1; AK3L1; AK6; AKL3L) (FITC); anti-AK3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D2
Specificity
Recognizes human AK3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-AK3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa25-87 from human AK3 (NP_057366) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.93kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.93kD).)

Western Blot (WB)

(AK3 monoclonal antibody, Western Blot analysis of AK3 expression in HepG2.)

Western Blot (WB) (AK3 monoclonal antibody, Western Blot analysis of AK3 expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of AK3 expression in transfected 293T cell line by AK3 monoclonal antibody. Lane 1: AK3 transfected lysate (25.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AK3 expression in transfected 293T cell line by AK3 monoclonal antibody. Lane 1: AK3 transfected lysate (25.6kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged AK3 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged AK3 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-AK3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,014 Da
NCBI Official Full Name
GTP:AMP phosphotransferase AK3, mitochondrial isoform a
NCBI Official Synonym Full Names
adenylate kinase 3
NCBI Official Symbol
AK3
NCBI Official Synonym Symbols
AK6; FIX; AK3L1; AKL3L; AKL3L1
NCBI Protein Information
GTP:AMP phosphotransferase AK3, mitochondrial
UniProt Protein Name
GTP:AMP phosphotransferase AK3, mitochondrial
UniProt Gene Name
AK3
UniProt Synonym Gene Names
AK 3

NCBI Description

The protein encoded by this gene is a GTP:ATP phosphotransferase that is found in the mitochondrial matrix. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Dec 2010]

Uniprot Description

Involved in maintaining the homeostasis of cellular nucleotides by catalyzing the interconversion of nucleoside phosphates. Has GTP:AMP phosphotransferase and ITP:AMP phosphotransferase activities.

Research Articles on AK3

Similar Products

Product Notes

The AK3 ak3 (Catalog #AAA6145836) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AK3 (GTP:AMP Phosphotransferase, Mitochondrial, Adenylate Kinase 3, AK 3, Adenylate Kinase 3 alpha-like 1, AK3L1, AK6, AKL3L) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AK3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AK3 ak3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AK3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.