Mouse anti-Human AHR Monoclonal Antibody | anti-AHR antibody

AHR (Aryl Hydrocarbon Receptor, Ah Receptor, AhR, Class E Basic Helix-loop-helix Protein 76, bHLHe76, BHLHE76) (HRP)

Cat. Num. AAA6151131

• Gene Names: AHR; bHLHe76
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: AHR; Monoclonal Antibody; AHR (Aryl Hydrocarbon Receptor; Ah Receptor; AhR; Class E Basic Helix-loop-helix Protein 76; bHLHe76; BHLHE76) (HRP); anti-AHR antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3B12
• Specificity: Recognizes human AHR.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-AHR antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa721-820 from human AHR (NP_001612) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINN
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of AHR over-expressed 293 cell line, cotransfected with AHR Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with 123091. GAPDH (36.1kD) used as specificity and loading control.)

Immunoprecipitation (IP)

(Immunoprecipitation of AHR transfected lysate using 123091 and Protein A Magnetic Bead and immunoblotted with AHR rabbit polyclonal antibody.)

Immunofluorescence (IF)

(Immunofluorescence to AHR on HeLa cell using 123091 (10ug/ml).)

Testing Data

(Detection limit for 123091 is ~0.03ng/ml as a capture antibody.)

Testing Data

()

Testing Data

()

Related Product Information for anti-AHR antibody

Aryl hydrocarbon receptor is a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. AHR has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450.

Product Categories/Family for anti-AHR antibody

Antibodies; Receptors

References

1. Malassezia-derived indoles activate the aryl hydrocarbon receptor and inhibit Toll-like receptor-induced maturation in monocyte-derived dendritic cells. Vlachos C, Schulte BM, Magiatis P, Adema GJ, Gaitanis G.Br J Dermatol. 2012 Apr 25. doi: 10.1111/j.1365-2133.2012.11014.x. 2. Diminished carcinogen detoxification is a novel mechanism for hypoxia-inducible factor 1-mediated genetic instability. Schults MA, Timmermans L, Godschalk RW, Theys J, Wouters BG, van Schooten FJ, Chiu RK.J Biol Chem. 2010 May 7;285(19):14558-64. Epub 2010 Mar 12.

NCBI and Uniprot Product Information

• NCBI GI #: 4502003
• NCBI GeneID: 196
• NCBI Accession #: NP_001612
• NCBI GenBank Nucleotide #: NM_001621
• UniProt Accession #: P35869; Q13728; Q13803; Q13804; A4D130
• Molecular Weight: 96,147 Da
• NCBI Official Full Name: aryl hydrocarbon receptor
• NCBI Official Synonym Full Names: aryl hydrocarbon receptor
• NCBI Official Symbol: AHR
• NCBI Official Synonym Symbols: bHLHe76
• NCBI Protein Information: aryl hydrocarbon receptor; AH-receptor; ah receptor; aromatic hydrocarbon receptor; class E basic helix-loop-helix protein 76
• UniProt Protein Name: Aryl hydrocarbon receptor
• Protein Family: Aldehyde reductase
• UniProt Gene Name: AHR
• UniProt Synonym Gene Names: BHLHE76; Ah receptor; AhR; bHLHe76
• UniProt Entry Name: AHR_HUMAN

Uniprot Description

AHR: a nuclear receptor for aryl hydrocarbons involved in xenobiotic metabolism, cell cycle regulation, and development in response to both endogenous and environmental signals. AhR was initially identified as a receptor for dioxins, which are environmental pollutants generated by waste incineration and other industrial processes . AhR ligands include polycyclic aromatic hydrocarbons, including the carcinogen benzo(a)pyrene and other components of cigarette smoke. Naturally occurring AhR ligands include flavonoids, which are aromatic plant secondary compounds commonly found in vegetables and fruits. Cytoplasmic aryl hydrocarbon receptors are found in protein complexes with heat shock proteins. Upon ligand binding, AhR dissociates from heat shock proteins and translocate to the nucleus where it dimerizes with AhR nuclear translocator (ARNT, HIF-1b). The AhR/ARNT heterodimer binds to nuclear xenobiotic response elements to control the expression of genes associated with xenobiotic metabolism, including several cytochrome P450 genes. AhR is ubiquitously expressed and is thought to play a role in regulation of cell proliferation and differentiation, cytokine expression, and xenobiotic metabolism. Research studies link AhR activity with the control of regulatory T-cell and T-helper 17 cell differentiation, regulation of the inflammatory response, and the onset of lung cancer.

Protein type: DNA-binding; Transcription factor; Nuclear receptor

Chromosomal Location of Human Ortholog: 7p15

Cellular Component: nucleoplasm; transcription factor complex; cytoplasm; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein dimerization activity; signal transducer activity; protein binding; ligand-dependent nuclear receptor activity; DNA binding; sequence-specific DNA binding; protein heterodimerization activity; Hsp90 protein binding; transcription factor activity; transcription factor binding

Biological Process: transcription from RNA polymerase II promoter; prostate gland development; blood vessel development; intracellular receptor-mediated signaling pathway; apoptosis; response to toxin; positive regulation of transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter; cell cycle; regulation of transcription from RNA polymerase II promoter; response to xenobiotic stimulus; regulation of transcription, DNA-dependent; regulation of gene expression; xenobiotic metabolic process; positive regulation of transcription from RNA polymerase II promoter; regulation of B cell proliferation; circadian regulation of gene expression; positive regulation of transcriptional preinitiation complex assembly; negative regulation of transcription, DNA-dependent