Western Blot (WB)
(Western Blot detection against Immunogen (36.01kD).)
Mouse anti-Human AF1Q Monoclonal Antibody | anti-AF1Q antibody
AF1Q (Protein AF1q, MLLT11, RP11-316M1.10) (FITC)
Gene Names
MLLT11; AF1Q
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AF1Q; Monoclonal Antibody; AF1Q (Protein AF1q; MLLT11; RP11-316M1.10) (FITC); anti-AF1Q antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A9-1B7
Specificity
Recognizes human AF1Q.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
1448
Applicable Applications for anti-AF1Q antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-91 from human AF1Q (AAH09624) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFELDLL
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (36.01kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (36.01kD).)
Testing Data
(Detection limit for recombinant GST tagged MLLT11 is ~0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged MLLT11 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-AF1Q antibody
Highly expressed in thymus and all leukemic cell lines.
Product Categories/Family for anti-AF1Q antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11, mRNA
NCBI Official Synonym Full Names
MLLT11 transcription factor 7 cofactor
NCBI Official Symbol
MLLT11
NCBI Official Synonym Symbols
AF1Q
NCBI Protein Information
protein AF1q
NCBI Description
The gene variously symbolized ALL1, HRX, or MLL located on 11q23 has been demonstrated to be fused with a number of translocation partners in cases of leukemia. t(1;11)(q21;q23) translocations that fused the MLL gene to a gene on chromosomal band 1q21 in 2 infants with acute myelomonocytic leukemia have been demonstrated. The N-terminal portion of the MLL gene is critical for leukemogenesis in translocations involving band 11q23. This gene encodes 90 amino acids. It was found to be highly expressed in the thymus but not in peripheral lymphoid tissues. In contrast to its restricted distribution in normal hematopoietic tissue, this gene was expressed in all leukemic cell lines tested. [provided by RefSeq, Jul 2008]
Research Articles on AF1Q
Similar Products
Product Notes
The AF1Q (Catalog #AAA6145814) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AF1Q (Protein AF1q, MLLT11, RP11-316M1.10) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AF1Q can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AF1Q for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AF1Q, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
