Mouse anti-Human ADAMTS8 Monoclonal Antibody | anti-ADAMTS8 antibody

ADAMTS8 (A Disintegrin and Metalloproteinase with Thrombospondin Motifs 8, ADAM-TS 8, ADAM-TS8, ADAMTS-8, METH-2, METH-8, METH2, FLJ41712) (HRP)

Cat. Num. AAA6151099

• Gene Names: ADAMTS8; METH2; ADAM-TS8
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ADAMTS8; Monoclonal Antibody; ADAMTS8 (A Disintegrin and Metalloproteinase with Thrombospondin Motifs 8; ADAM-TS 8; ADAM-TS8; ADAMTS-8; METH-2; METH-8; METH2; FLJ41712) (HRP); anti-ADAMTS8 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5A3
• Specificity: Recognizes human ADAMTS8.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 889

• Applicable Applications for anti-ADAMTS8 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa781-891 from human ADAMTS8 (NP_008968) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RPLPEPLTVQLLTVPGEVFPPKVKYTFFVPNDVDFSMQSSKERATTNIIQPLLHAQWVLGDWSECSSTCGAGWQRRTVECRDPSGQASATCNKALKPEDAKPCESQLCPL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Testing Data

(Detection limit for recombinant GST tagged ADAMTS8 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-ADAMTS8 antibody

Antibodies; Matrix Metalloproteinases

NCBI and Uniprot Product Information

• NCBI GI #: 153792351
• NCBI GeneID: 11095
• NCBI Accession #: NP_008968
• NCBI GenBank Nucleotide #: NM_007037
• UniProt Accession #: Q9UP79
• NCBI Official Full Name: A disintegrin and metalloproteinase with thrombospondin motifs 8 preproprotein
• NCBI Official Synonym Full Names: ADAM metallopeptidase with thrombospondin type 1 motif 8
• NCBI Official Symbol: ADAMTS8
• NCBI Official Synonym Symbols: METH2; ADAM-TS8
• NCBI Protein Information: A disintegrin and metalloproteinase with thrombospondin motifs 8
• UniProt Protein Name: A disintegrin and metalloproteinase with thrombospondin motifs 8
• Protein Family: A disintegrin and metalloproteinase with thrombospondin motifs
• UniProt Gene Name: ADAMTS8
• UniProt Synonym Gene Names: METH2; ADAM-TS 8; ADAM-TS8; ADAMTS-8

NCBI Description

This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature enzyme. This enzyme contains two C-terminal TS motifs, and disrupts angiogenesis in vivo. A number of disorders have been mapped in the vicinity of this gene, most notably lung neoplasms. Reduced expression of this gene has been observed in multiple human cancers and this gene has been proposed as a potential tumor suppressor. [provided by RefSeq, Feb 2016]

Uniprot Description

Has anti-angiogenic properties.