Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ADAM17 monoclonal antibody. Western Blot analysis of ADAM17 expression in human spleen.)

Mouse anti-Human ADAM17 Monoclonal Antibody | anti-ADAM17 antibody

ADAM17 (Disintegrin and Metalloproteinase Domain-containing Protein 17, Snake Venom-like Protease, TNF-alpha Convertase, TNF-alpha-converting Enzyme, CD156b, CSVP, TACE, ADAM17, MGC71942) (HRP)

Gene Names
ADAM17; CSVP; TACE; NISBD; ADAM18; CD156B; NISBD1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ADAM17; Monoclonal Antibody; ADAM17 (Disintegrin and Metalloproteinase Domain-containing Protein 17; Snake Venom-like Protease; TNF-alpha Convertase; TNF-alpha-converting Enzyme; CD156b; CSVP; TACE; MGC71942) (HRP); anti-ADAM17 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1F6
Specificity
Recognizes human ADAM17.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-ADAM17 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa215-315 from human ADAM17 (NP_003174) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RADPDPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDV
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ADAM17 monoclonal antibody. Western Blot analysis of ADAM17 expression in human spleen.)

Western Blot (WB) (ADAM17 monoclonal antibody. Western Blot analysis of ADAM17 expression in human spleen.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ADAM17 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ADAM17 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged ADAM17 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ADAM17 is ~3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between TGFA and ADAM17. HeLa cells were stained with TGFA rabbit purified polyclonal 1:1200 and ADAM17 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between TGFA and ADAM17. HeLa cells were stained with TGFA rabbit purified polyclonal 1:1200 and ADAM17 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Product Categories/Family for anti-ADAM17 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 93 kDa
NCBI Official Full Name
disintegrin and metalloproteinase domain-containing protein 17 preproprotein
NCBI Official Synonym Full Names
ADAM metallopeptidase domain 17
NCBI Official Symbol
ADAM17
NCBI Official Synonym Symbols
CSVP; TACE; NISBD; ADAM18; CD156B; NISBD1
NCBI Protein Information
disintegrin and metalloproteinase domain-containing protein 17; TNF-alpha convertase; snake venom-like protease; TNF-alpha converting enzyme; ADAM metallopeptidase domain 18; tumor necrosis factor, alpha, converting enzyme
UniProt Protein Name
Disintegrin and metalloproteinase domain-containing protein 17
UniProt Gene Name
ADAM17
UniProt Synonym Gene Names
CSVP; TACE; ADAM 17
UniProt Entry Name
ADA17_HUMAN

NCBI Description

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biologic processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene functions as a tumor necrosis factor-alpha converting enzyme; binds mitotic arrest deficient 2 protein; and also plays a prominent role in the activation of the Notch signaling pathway. [provided by RefSeq, Jul 2008]

Uniprot Description

TACE: a type I membrane protein with disintegrin and metalloprotease activity. An ubiquitously expressed ectoenzyme of peptidase family M12B. Must be membrane anchored to cleave the different substrates. The cytoplasmic domain is not required for the this activity. Possesses a narrow endopeptidase specificity. Cleaves Pro-Leu-Ala-Gln-Ala-|-Val-Arg-Ser-Ser-Ser in the membrane-bound, 26-kDa form of tumor necrosis factor alpha (TNF-alpha) to its mature soluble form. Responsible for the proteolytic release of several other cell-surface proteins, including p75 TNF-receptor, interleukin 1 receptor type II, p55 TNF-receptor, transforming growth factor-alpha, L-selectin, and the amyloid precursor protein. Also involved in the activation of Notch pathway. Binds 1 zinc ion per subunit. Two splice variant isoforms have been described.

Protein type: Motility/polarity/chemotaxis; EC 3.4.24.86; Protease; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2p25

Cellular Component: cell surface; focal adhesion; membrane; integral to plasma membrane; apical plasma membrane; cytoplasm; plasma membrane; intercellular junction; actin cytoskeleton; lipid raft

Molecular Function: integrin binding; protein binding; interleukin-6 receptor binding; zinc ion binding; metallopeptidase activity; metalloendopeptidase activity; Notch binding; SH3 domain binding; PDZ domain binding

Biological Process: extracellular matrix organization and biogenesis; nerve growth factor receptor signaling pathway; cell motility involved in cell locomotion; neutrophil mediated immunity; T cell differentiation in the thymus; response to lipopolysaccharide; positive regulation of leukocyte chemotaxis; proteolysis; G1/S-specific positive regulation of cyclin-dependent protein kinase activity; extracellular matrix disassembly; positive regulation of epidermal growth factor receptor activity; positive regulation of cell proliferation; negative regulation of interleukin-8 production; germinal center formation; cell adhesion; response to drug; spleen development; epidermal growth factor receptor signaling pathway; Notch signaling pathway; membrane protein intracellular domain proteolysis; response to high density lipoprotein stimulus; membrane protein ectodomain proteolysis; positive regulation of transforming growth factor beta receptor signaling pathway; Notch receptor processing; positive regulation of cell motility; positive regulation of cell growth; positive regulation of chemokine production; collagen catabolic process; regulation of mast cell apoptosis; PMA-inducible membrane protein ectodomain proteolysis; B cell differentiation; response to hypoxia; cell adhesion mediated by integrin; positive regulation of protein amino acid phosphorylation; negative regulation of transforming growth factor beta receptor signaling pathway; wound healing, spreading of epidermal cells; positive regulation of cell migration

Disease: Inflammatory Skin And Bowel Disease, Neonatal, 1

Research Articles on ADAM17

Similar Products

Product Notes

The ADAM17 adam17 (Catalog #AAA6151085) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ADAM17 (Disintegrin and Metalloproteinase Domain-containing Protein 17, Snake Venom-like Protease, TNF-alpha Convertase, TNF-alpha-converting Enzyme, CD156b, CSVP, TACE, ADAM17, MGC71942) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADAM17 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ADAM17 adam17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ADAM17, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.