Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.18kD).)

Mouse anti-Human ADAM11 Monoclonal Antibody | anti-ADAM11 antibody

ADAM11 (MDC, Disintegrin and Metalloproteinase Domain-containing Protein 11, Metalloproteinase-like, Disintegrin-like, and Cysteine-rich Protein) (Biotin)

Gene Names
ADAM11; MDC
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ADAM11; Monoclonal Antibody; ADAM11 (MDC; Disintegrin and Metalloproteinase Domain-containing Protein 11; Metalloproteinase-like; Disintegrin-like; and Cysteine-rich Protein) (Biotin); anti-ADAM11 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3D4
Specificity
Recognizes human ADAM11.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
769
Applicable Applications for anti-ADAM11 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa230-333 from human ADAM11 (NP_002381) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGR
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.18kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.18kD).)

Western Blot (WB)

(ADAM11 monoclonal antibody. Western Blot analysis of ADAM11 expression in human colon.)

Western Blot (WB) (ADAM11 monoclonal antibody. Western Blot analysis of ADAM11 expression in human colon.)

Testing Data

(Detection limit for recombinant GST tagged ADAM11 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ADAM11 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-ADAM11 antibody
This gene encodes a member of the ADAM (a disintegrin and metalloprotease) protein family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This gene represents a candidate tumor supressor gene for human breast cancer based on its location within a minimal region of chromosome 17q21 previously defined by tumor deletion mapping. [provided by RefSeq].
Product Categories/Family for anti-ADAM11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
disintegrin and metalloproteinase domain-containing protein 11 isoform 1 preproprotein
NCBI Official Synonym Full Names
ADAM metallopeptidase domain 11
NCBI Official Symbol
ADAM11
NCBI Official Synonym Symbols
MDC
NCBI Protein Information
disintegrin and metalloproteinase domain-containing protein 11
UniProt Protein Name
Disintegrin and metalloproteinase domain-containing protein 11
UniProt Gene Name
ADAM11
UniProt Synonym Gene Names
MDC; ADAM 11; MDC
UniProt Entry Name
ADA11_HUMAN

NCBI Description

This gene encodes a member of the ADAM (a disintegrin and metalloprotease) protein family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The encoded preproprotein is proteolytically processed to generate the mature protease. This gene represents a candidate tumor suppressor gene for human breast cancer based on its location within a minimal region of chromosome 17q21 previously defined by tumor deletion mapping. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016]

Uniprot Description

Function: Probable ligand for integrin in the brain. This is a non catalytic metalloprotease-like protein.

Subunit structure: Can bind to LGI1 and LGI4

By similarity.

Subcellular location: Membrane; Single-pass type I membrane protein.

Tissue specificity: Expressed predominantly in brain. Slightly detected or not at all in other tissues.

Domain: A conserved motif [AVN[ED]CD] within the disintegrin-like domain could be involved in the binding to the integrin receptor.

Post-translational modification: The precursor is cleaved by a furin endopeptidase

By similarity.

Sequence similarities: Contains 1 disintegrin domain.Contains 1 EGF-like domain.Contains 1 peptidase M12B domain.

Research Articles on ADAM11

Similar Products

Product Notes

The ADAM11 adam11 (Catalog #AAA6140480) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ADAM11 (MDC, Disintegrin and Metalloproteinase Domain-containing Protein 11, Metalloproteinase-like, Disintegrin-like, and Cysteine-rich Protein) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADAM11 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ADAM11 adam11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ADAM11, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.