Mouse anti-Human ACVRL1 Monoclonal Antibody | anti-ACVRL1 antibody

ACVRL1 (Serine/Threonine-protein Kinase Receptor R3, SKR3, Activin Receptor-like Kinase 1, ALK-1, TGF-B Superfamily Receptor Type I, TSR-I, ACVRLK1, ALK1) (AP)

Cat. Num. AAA6129868

• Gene Names: ACVRL1; HHT; ALK1; HHT2; ORW2; SKR3; ALK-1; TSR-I; ACVRLK1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ACVRL1; Monoclonal Antibody; ACVRL1 (Serine/Threonine-protein Kinase Receptor R3; SKR3; Activin Receptor-like Kinase 1; ALK-1; TGF-B Superfamily Receptor Type I; TSR-I; ACVRLK1; ALK1) (AP); anti-ACVRL1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5B1
• Specificity: Recognizes human ACVRL1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-ACVRL1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa22-119 from human ACVRL1 (AAH42637) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.41kD).)

Western Blot (WB)

(Western Blot analysis of ACVRL1 expression in transfected 293T cell line by ACVRL1 monoclonal antibody. Lane 1: ACVRL1 transfected lysate (56.124kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-ACVRL1 antibody

ACVRL1 is a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. This protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases. Mutations in this gene are associated with hemorrhagic telangiectasia type 2, also known as Rendu-Osler-Weber syndrome 2.

Product Categories/Family for anti-ACVRL1 antibody

Antibodies; Activin Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 27769257
• NCBI GeneID: 94
• Molecular Weight: 56,124 Da
• NCBI Official Full Name: Homo sapiens activin A receptor type II-like 1, mRNA
• NCBI Official Synonym Full Names: activin A receptor like type 1
• NCBI Official Symbol: ACVRL1
• NCBI Official Synonym Symbols: HHT; ALK1; HHT2; ORW2; SKR3; ALK-1; TSR-I; ACVRLK1
• NCBI Protein Information: serine/threonine-protein kinase receptor R3
• Protein Family: Serine/threonine-protein kinase receptor

NCBI Description

This gene encodes a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. The encoded protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases. Mutations in this gene are associated with hemorrhagic telangiectasia type 2, also known as Rendu-Osler-Weber syndrome 2. [provided by RefSeq, Jul 2008]