Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ACTR1A Monoclonal Antibody | anti-ACTR1A antibody

ACTR1A (Alpha-centractin, Centractin, ARP1, Actin-RPV, Centrosome-associated Actin Homolog, CTRN1, FLJ52695, FLJ52800, FLJ55002) (MaxLight 490)

Gene Names
ACTR1A; ARP1; CTRN1
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ACTR1A; Monoclonal Antibody; ACTR1A (Alpha-centractin; Centractin; ARP1; Actin-RPV; Centrosome-associated Actin Homolog; CTRN1; FLJ52695; FLJ52800; FLJ55002) (MaxLight 490); anti-ACTR1A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E5
Specificity
Recognizes human ACTR1A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-ACTR1A antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa279-375 from ACTR1A (NP_005727) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKT
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ACTR1A antibody
This gene encodes a 42.6kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22-150kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin.
Product Categories/Family for anti-ACTR1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,614 Da
NCBI Official Full Name
alpha-centractin
NCBI Official Synonym Full Names
ARP1 actin-related protein 1 homolog A, centractin alpha (yeast)
NCBI Official Symbol
ACTR1A
NCBI Official Synonym Symbols
ARP1; CTRN1
NCBI Protein Information
alpha-centractin; actin-RPV; centrosome-associated actin homolog
UniProt Protein Name
Alpha-centractin
Protein Family
UniProt Gene Name
ACTR1A
UniProt Synonym Gene Names
CTRN1; Centractin
UniProt Entry Name
ACTZ_HUMAN

Similar Products

Product Notes

The ACTR1A actr1a (Catalog #AAA6199397) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ACTR1A (Alpha-centractin, Centractin, ARP1, Actin-RPV, Centrosome-associated Actin Homolog, CTRN1, FLJ52695, FLJ52800, FLJ55002) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACTR1A can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ACTR1A actr1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACTR1A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.