Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ACADM Monoclonal Antibody | anti-ACADM antibody

ACADM (Medium-chain Specific Acyl-CoA Dehydrogenase, Mitochondrial, MCAD) (MaxLight 750)

Gene Names
ACADM; MCAD; ACAD1; MCADH
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ACADM; Monoclonal Antibody; ACADM (Medium-chain Specific Acyl-CoA Dehydrogenase; Mitochondrial; MCAD) (MaxLight 750); anti-ACADM antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3A2
Specificity
Recognizes human ACADM.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-ACADM antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human ACADM (NP_000007) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGL
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ACADM antibody
ACADM is the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway.
Product Categories/Family for anti-ACADM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
34
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45.9 kDa (417aa) confirmed by MALDI-TOF
NCBI Official Full Name
medium-chain specific acyl-CoA dehydrogenase, mitochondrial isoform a
NCBI Official Synonym Full Names
acyl-CoA dehydrogenase medium chain
NCBI Official Symbol
ACADM
NCBI Official Synonym Symbols
MCAD; ACAD1; MCADH
NCBI Protein Information
medium-chain specific acyl-CoA dehydrogenase, mitochondrial
UniProt Protein Name
Medium-chain specific acyl-CoA dehydrogenase, mitochondrial
UniProt Gene Name
ACADM
UniProt Synonym Gene Names
MCAD
UniProt Entry Name
ACADM_HUMAN

NCBI Description

This gene encodes the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Defects in this gene cause medium-chain acyl-CoA dehydrogenase deficiency, a disease characterized by hepatic dysfunction, fasting hypoglycemia, and encephalopathy, which can result in infantile death. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ACADM: This enzyme is specific for acyl chain lengths of 4 to 16. Defects in ACADM are the cause of acyl-CoA dehydrogenase medium-chain deficiency (ACADMD). It is an autosomal recessive disease which causes fasting hypoglycemia, hepatic dysfunction, and encephalopathy, often resulting in death in infancy. Belongs to the acyl-CoA dehydrogenase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.3.8.7; Mitochondrial; Carbohydrate Metabolism - propanoate; Oxidoreductase; Lipid Metabolism - fatty acid; Amino Acid Metabolism - valine, leucine and isoleucine degradation; Other Amino Acids Metabolism - beta-alanine

Chromosomal Location of Human Ortholog: 1p31

Cellular Component: mitochondrion; axon; mitochondrial matrix; nucleus

Molecular Function: acyl-CoA dehydrogenase activity; identical protein binding; FAD binding

Biological Process: carnitine metabolic process, CoA-linked; fatty acid beta-oxidation; medium-chain fatty acid catabolic process; cellular lipid metabolic process; medium-chain fatty acid metabolic process; fatty acid beta-oxidation using acyl-CoA dehydrogenase; carnitine biosynthetic process

Disease: Acyl-coa Dehydrogenase, Medium-chain, Deficiency Of

Research Articles on ACADM

Similar Products

Product Notes

The ACADM acadm (Catalog #AAA6231391) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ACADM (Medium-chain Specific Acyl-CoA Dehydrogenase, Mitochondrial, MCAD) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACADM can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ACADM acadm for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACADM, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.