Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human ABI3BP Monoclonal Antibody | anti-ABI3BP antibody

ABI3BP (NESHBP, TARSH, Target of Nesh-SH3, ABI Gene Family Member 3-binding Protein, Nesh-binding Protein) (HRP)

Gene Names
ABI3BP; TARSH; NESHBP
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ABI3BP; Monoclonal Antibody; ABI3BP (NESHBP; TARSH; Target of Nesh-SH3; ABI Gene Family Member 3-binding Protein; Nesh-binding Protein) (HRP); anti-ABI3BP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2B8
Specificity
Recognizes human ABI3BP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-ABI3BP antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa511-610 from human BI3BP (NP_056244) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KTQFISLKPKIPLSPEVTHTKPAPKQTPRAPPKPKTSPRPRIPQTQPVPKVPQRVTAKPKTSPSPEVSYTTPAPKDVLLPHKPYPEVSQSEPAPLETRG*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Testing Data

(Detection limit for recombinant GST tagged ABI3BP is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ABI3BP is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-ABI3BP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86,789 Da
NCBI Official Full Name
target of Nesh-SH3
NCBI Official Synonym Full Names
ABI family, member 3 (NESH) binding protein
NCBI Official Symbol
ABI3BP
NCBI Official Synonym Symbols
TARSH; NESHBP
NCBI Protein Information
target of Nesh-SH3; ABI gene family member 3-binding protein; ABI gene family, member 3 (NESH) binding protein; nesh-binding protein
UniProt Protein Name
Target of Nesh-SH3
Protein Family
UniProt Gene Name
ABI3BP
UniProt Synonym Gene Names
NESHBP; TARSH; Tarsh; NeshBP
UniProt Entry Name
TARSH_HUMAN

Uniprot Description

ABI3BP: 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 3q12

Cellular Component: extracellular matrix; extracellular space

Molecular Function: collagen binding; heparin binding

Biological Process: extracellular matrix organization and biogenesis

Similar Products

Product Notes

The ABI3BP abi3bp (Catalog #AAA6151032) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ABI3BP (NESHBP, TARSH, Target of Nesh-SH3, ABI Gene Family Member 3-binding Protein, Nesh-binding Protein) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ABI3BP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ABI3BP abi3bp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ABI3BP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.