Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ABHD5 Monoclonal Antibody | anti-ABHD5 antibody

ABHD5 (Abhydrolase Domain Containing 5, CDS, CGI58, IECN2, MGC8731, NCIE2) (FITC)

Gene Names
ABHD5; CGI58; IECN2; NCIE2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
ABHD5; Monoclonal Antibody; ABHD5 (Abhydrolase Domain Containing 5; CDS; CGI58; IECN2; MGC8731; NCIE2) (FITC); anti-ABHD5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4B12
Specificity
Recognizes human ABHD5.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-ABHD5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa240-342 from human ABHD5 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRP MLQRIGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPH SYVKTIAILGAGHYVYADQPEEFNQKVK
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-ABHD5 antibody
The protein encoded by this gene belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.
Product Categories/Family for anti-ABHD5 antibody
References
1. The Cannabinoid Receptor Agonist THC Attenuates Weight Loss in a Rodent Model of Activity-Based Anorexia. Verty AN, Evetts MJ, Crouch GJ, McGregor IS, Stefanidis A, Oldfield BJ. Neuropsychopharmacology. 2011 Jun;36(7):1349-58. Epub 2011 Mar 16. 2. Adipose triacylglycerol lipase deletion alters whole body energy metabolism and impairs exercise performance in mice. Huijsman E, van de Par C, Economou C, van der Poel C, Lynch GS, Schoiswohl G, Haemmerle G, Zechner R, Watt MJ. Am J Physiol Endocrinol Metab. 2009 Aug;297(2):E505-13. Epub 2009 Jun 2. 3. Adipose Triglyceride Lipase Regulation of Skeletal Muscle Lipid Metabolism and Insulin Responsiveness. Watt MJ, van Denderen BJ, Castelli LA, Bruce CR, Hoy AJ, Kraegen EW, Macaulay L, Kemp BE. Mol Endocrinol. 2008 May;22(5):1200-12. Epub 2008 Jan 17.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
1-acylglycerol-3-phosphate O-acyltransferase ABHD5 isoform a
NCBI Official Synonym Full Names
abhydrolase domain containing 5
NCBI Official Symbol
ABHD5
NCBI Official Synonym Symbols
CGI58; IECN2; NCIE2
NCBI Protein Information
1-acylglycerol-3-phosphate O-acyltransferase ABHD5
UniProt Protein Name
1-acylglycerol-3-phosphate O-acyltransferase ABHD5
UniProt Gene Name
ABHD5
UniProt Synonym Gene Names
NCIE2

NCBI Description

The protein encoded by this gene belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation. [provided by RefSeq, Jul 2008]

Uniprot Description

ABHD5: a lysophosphatidic acid acyltransferase which functions in phosphatidic acid biosynthesis. May regulate the cellular storage of triacylglycerol through activation of the phospholipase PNPLA2. Involved in keratinocyte differentiation. Colocalized with PLIN and ADFP on the surface of lipid droplets. The localization is dependent upon the metabolic status of the adipocytes and the activity of PKA. Defects cause neutral lipid storage disease (NLSD), an autosomal recessive disorder characterized by the excessive accumulation of neutral lipids in multiple tissues, and Chanarin-Dorfman syndrome (CDS), a triglyceride storage disease with impaired long-chain fatty acid oxidation and icthyosis. CDS is an autosomal recessive inborn error of lipid metabolism with multisystemic accumulation of triglycerides although plasma concentrations are normal. Widely expressed in various tissues, including lymphocytes, liver, skeletal muscle and brain. Expressed by upper epidermal layers and dermal fibroblasts in skin, hepatocytes and neurons.

Protein type: EC 2.3.1.51; Lipase; Transferase

Chromosomal Location of Human Ortholog: 3p21.33

Cellular Component: cytoplasm; cytosol; intracellular membrane-bound organelle; lipid particle; nucleus

Molecular Function: lysophosphatidic acid acyltransferase activity; triacylglycerol lipase activity

Biological Process: phosphatidic acid biosynthetic process

Disease: Chanarin-dorfman Syndrome

Research Articles on ABHD5

Similar Products

Product Notes

The ABHD5 abhd5 (Catalog #AAA6150628) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ABHD5 (Abhydrolase Domain Containing 5, CDS, CGI58, IECN2, MGC8731, NCIE2) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ABHD5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ABHD5 abhd5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ABHD5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.