Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse ABCC1 Monoclonal Antibody | anti-ABCC1 antibody

ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1, ABC29, ABCC, DKFZp686N04233, DKFZp781G125, GS-X, MRP, MRP1) (FITC)

Gene Names
ABCC1; MRP; ABCC; GS-X; MRP1; ABC29
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
ABCC1; Monoclonal Antibody; ABCC1 (ATP-Binding Cassette; Sub-Family C (CFTR/MRP); Member 1; ABC29; ABCC; DKFZp686N04233; DKFZp781G125; GS-X; MRP; MRP1) (FITC); ATP-Binding Cassette; MRP1; anti-ABCC1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1G8
Specificity
Recognizes ABCC1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-ABCC1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ABCC1 (NP_004987, 816aa-915aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-ABCC1 antibody
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternative splicing by exon deletion results in several splice variants but maintains the original open reading frame in all forms. [provided by RefSeq]
Product Categories/Family for anti-ABCC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
172,640 Da
NCBI Official Full Name
multidrug resistance-associated protein 1
NCBI Official Synonym Full Names
ATP-binding cassette, sub-family C (CFTR/MRP), member 1
NCBI Official Symbol
ABCC1
NCBI Official Synonym Symbols
MRP; ABCC; GS-X; MRP1; ABC29
NCBI Protein Information
multidrug resistance-associated protein 1; ATP-binding cassette transporter variant ABCC1delta-ex13; ATP-binding cassette transporter variant ABCC1delta-ex13&14; ATP-binding cassette transporter variant ABCC1delta-ex25; ATP-binding cassette transporte
UniProt Protein Name
Multidrug resistance-associated protein 1
Protein Family
UniProt Gene Name
ABCC1
UniProt Synonym Gene Names
MRP; MRP1; LTC4 transporter
UniProt Entry Name
MRP1_HUMAN

Similar Products

Product Notes

The ABCC1 abcc1 (Catalog #AAA6174891) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ABCC1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ABCC1 abcc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ABCC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.