Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human ABCB9 Monoclonal Antibody | anti-ABCB9 antibody

ABCB9 (ATP-binding Cassette Sub-family B Member 9, ATP-binding Cassette Transporter 9, ABC Transporter 9 Protein, hABCB9, TAP-like Protein, TAPL, KIAA1520) (FITC)

Gene Names
ABCB9; TAPL; EST122234
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ABCB9; Monoclonal Antibody; ABCB9 (ATP-binding Cassette Sub-family B Member 9; ATP-binding Cassette Transporter 9; ABC Transporter 9 Protein; hABCB9; TAP-like Protein; TAPL; KIAA1520) (FITC); anti-ABCB9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4F4
Specificity
Recognizes human ABCB9.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
766
Applicable Applications for anti-ABCB9 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa482-581 from ABCB9 (NP_062571) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FIDRQPTMVHDGSLAPDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLEGGRVLLDGKPISAYDHKYLHR*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)
Related Product Information for anti-ABCB9 antibody
The membrane-associated protein ABCB9 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. The function of this half-transporter has not yet been determined; however, this protein may play a role in lysosomes. Alternative splicing of this gene results in three known products which are likely to have different substrate specifications.
Product Categories/Family for anti-ABCB9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ATP-binding cassette sub-family B member 9 isoform 1
NCBI Official Synonym Full Names
ATP binding cassette subfamily B member 9
NCBI Official Symbol
ABCB9
NCBI Official Synonym Symbols
TAPL; EST122234
NCBI Protein Information
ATP-binding cassette sub-family B member 9
UniProt Protein Name
ATP-binding cassette sub-family B member 9
Protein Family
UniProt Gene Name
ABCB9
UniProt Synonym Gene Names
KIAA1520; ABC transporter 9 protein; hABCB9; TAPL
UniProt Entry Name
ABCB9_HUMAN

NCBI Description

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. This family member functions in the translocation of peptides from the cytosol into the lysosomal lumen. Alternative splicing of this gene results in distinct isoforms which are likely to have different substrate specificities. [provided by RefSeq, Jul 2011]

Uniprot Description

ABCB9: ATP-dependent low-affinity peptide transporter which translocates a broad spectrum of peptides from the cytosol to the lysosomal lumen. Displays a broad peptide length specificity from 6-mer up to at least 59-mer peptides with an optimum of 23-mers. Favors positively charged, aromatic or hydrophobic residues in the N- and C-terminal positions whereas negatively charged residues as well as asparagine and methionine are not favored. Belongs to the ABC transporter superfamily. ABCB family. MHC peptide exporter (TC 3.A.1.209) subfamily. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, ABC family; Membrane protein, multi-pass; Membrane protein, integral; Transporter

Chromosomal Location of Human Ortholog: 12q24

Cellular Component: lysosomal membrane; lysosome; endoplasmic reticulum; early endosome; integral to membrane; integral to endoplasmic reticulum membrane

Molecular Function: protein binding; protein homodimerization activity; substrate-specific transmembrane transporter activity; ATP binding; peptide-transporting ATPase activity

Biological Process: peptide transport; antigen processing and presentation of peptide antigen via MHC class I; protein transport; metabolic process; transmembrane transport

Research Articles on ABCB9

Similar Products

Product Notes

The ABCB9 abcb9 (Catalog #AAA6145717) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ABCB9 (ATP-binding Cassette Sub-family B Member 9, ATP-binding Cassette Transporter 9, ABC Transporter 9 Protein, hABCB9, TAP-like Protein, TAPL, KIAA1520) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ABCB9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ABCB9 abcb9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ABCB9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.