Mouse anti-Human AATF Monoclonal Antibody | anti-AATF antibody

AATF (Apoptosis Antagonizing Transcription Factor, CHE1, CHE-1, DED, HSPC277, Protein AATF, Rb-binding Protein Che-1) (AP)

Cat. Num. AAA6129804

• Gene Names: AATF; DED; BFR2; CHE1; CHE-1
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: AATF; Monoclonal Antibody; AATF (Apoptosis Antagonizing Transcription Factor; CHE1; CHE-1; DED; HSPC277; Protein AATF; Rb-binding Protein Che-1) (AP); anti-AATF antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3C7
• Specificity: Recognizes human AATF.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-AATF antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa151-250 from human AATF (AAH00591) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLT
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(AATF monoclonal antibody. Western Blot analysis of AATF expression in Hela NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to AATF on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to AATF on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged AATF is 0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-AATF antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 33875610
• NCBI GeneID: 26574
• Molecular Weight: 63,133 Da
• NCBI Official Full Name: Homo sapiens apoptosis antagonizing transcription factor, mRNA
• NCBI Official Synonym Full Names: apoptosis antagonizing transcription factor
• NCBI Official Symbol: AATF
• NCBI Official Synonym Symbols: DED; BFR2; CHE1; CHE-1
• NCBI Protein Information: protein AATF; apoptosis-antagonizing transcription factor; rb-binding protein Che-1
• Protein Family: Protein

NCBI Description

The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis. [provided by RefSeq, Jul 2008]