Mouse anti-Human AADAC Monoclonal Antibody | anti-AADAC antibody

AADAC (Arylacetamide Deacetylase, DAC) (HRP)

Cat. Num. AAA6151012

• Gene Names: AADAC; DAC; CES5A1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: AADAC; Monoclonal Antibody; AADAC (Arylacetamide Deacetylase; DAC) (HRP); anti-AADAC antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2E8
• Specificity: Recognizes human AADAC.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-AADAC antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa201-300 from human AADAC (NP_001077) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFINWSSLLPERFIKGHVYNNP
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged AADAC is ~3ng/ml as a capture antibody.)

Related Product Information for anti-AADAC antibody

Arylacetamide deacetylation is an important enzyme activity in the metabolic activation of arylamine substrates to ultimate carcinogens. Displays major serine hydrolase activity in liver microsomes. Hydrolyzes also flutamide, which is an antiandrogen drug used for the treatment of prostate cancer that occasionally causes severe hepatotoxicity. Displays cellular triglyceride lipase activity in liver. Increases intracellular fatty acids derived from hydrolysis of newly formed triglyceride stores.

Product Categories/Family for anti-AADAC antibody

Antibodies; Enzymes

References

1. Shimizu M, Fukami T, Kobayashi Y, Takamiya M, Aoki Y, Nakajima M, Yokoi T.Drug Metab Dispos. 2012 Mar 13. 2. Kobayashi Y, Fukami T, Nakajima A, Watanabe A, Nakajima M, Yokoi T.Drug Metab Dispos. 2012 Apr;40(4):671-9. Epub 2011 Dec 29. 3. Watanabe A, Fukami T, Nakajima M, Takamiya M, Aoki Y, Yokoi T.Drug Metab Dispos. 2009 Jul;37(7):1513-20. Epub 2009 Apr 1.

NCBI and Uniprot Product Information

• NCBI GI #: 68299767
• NCBI GeneID: 13
• NCBI Accession #: NP_001077
• NCBI GenBank Nucleotide #: NM_001086
• UniProt Accession #: P22760
• Molecular Weight: 46kDa
• NCBI Official Full Name: arylacetamide deacetylase
• NCBI Official Synonym Full Names: arylacetamide deacetylase
• NCBI Official Symbol: AADAC
• NCBI Official Synonym Symbols: DAC; CES5A1
• NCBI Protein Information: arylacetamide deacetylase
• UniProt Protein Name: Arylacetamide deacetylase
• Protein Family: Arylacetamide deacetylase
• UniProt Gene Name: AADAC
• UniProt Synonym Gene Names: DAC
• UniProt Entry Name: AAAD_HUMAN

NCBI Description

Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens [provided by RefSeq, Jul 2008]

Uniprot Description

AADAC: Arylacetamide deacetylation is an important enzyme activity in the metabolic activation of arylamine substrates to ultimate carcinogens. Displays major serine hydrolase activity in liver microsomes. Hydrolyzes also flutamide, which is an antiandrogen drug used for the treatment of prostate cancer that occasionaly causes severe hepatotoxicity. Displays cellular triglyceride lipase activity in liver. Increases intracellular fatty acids derived from hydrolysis of newly formed triglyceride stores. Belongs to the 'GDXG' lipolytic enzyme family.

Protein type: Endoplasmic reticulum; Membrane protein, integral; Deacetylase; Motility/polarity/chemotaxis; EC 3.1.1.3; Lipase

Chromosomal Location of Human Ortholog: 3q25.1

Cellular Component: endoplasmic reticulum membrane; integral to membrane

Molecular Function: deacetylase activity; triacylglycerol lipase activity; serine hydrolase activity; lipase activity; catalytic activity

Biological Process: metabolic process