<
Western Blot (WB)
(Western Blot detection against Immunogen (66.11kD).)
Mouse anti-Human 2019-09-01 Monoclonal Antibody | anti-SEPT1 antibody
SEPT1 (Septin-1, LARP, Peanut-like Protein 3, Serologically Defined Breast Cancer Antigen NY-BR-24, DIFF6, PNUTL3) (PE)
Gene Names
SEPTIN1; LARP; SEP1; DIFF6; SEPT1; PNUTL3
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
2019-09-01; Monoclonal Antibody; SEPT1 (Septin-1; LARP; Peanut-like Protein 3; Serologically Defined Breast Cancer Antigen NY-BR-24; DIFF6; PNUTL3) (PE); anti-SEPT1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F12
Specificity
Recognizes human SEPT1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
1455
Applicable Applications for anti-SEPT1 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-367 from human SEPT1 (AAH12161) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDKEYVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQVPEASARLTQTLAIERRGVEIEEGGVKVKLTLVDTPGFGDSVDCSDCWLPVVKFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYFISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADALMPQETQALKQKIRDQLKEEEIHIYQFPECDSDEDEDFKRQDAEMKESIPFAVVGSCEVVRDGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARRLQSLARPGARDRASRSKLSRQSATEIPLPMLPLADTEKLIREKDEELRRMQEMLEKMQAQMQRSQAQGEQSDAL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (66.11kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (66.11kD).)
Western Blot (WB)
(Western Blot analysis of SEPT1 expression in transfected 293T cell line by SEPT1 monoclonal antibody. Lane 1: SEPT1 transfected lysate (42kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of SEPT1 expression in transfected 293T cell line by SEPT1 monoclonal antibody. Lane 1: SEPT1 transfected lysate (42kD). Lane 2: Non-transfected lysate.)
Immunoprecipitation (IP)
(Immunoprecipitation of SEPT1 transfected lysate using SEPT1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SEPT1 rabbit polyclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of SEPT1 transfected lysate using SEPT1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SEPT1 rabbit polyclonal antibody.)
Testing Data
(Detection limit for recombinant GST tagged SEPT1 is 3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged SEPT1 is 3ng/ml as a capture antibody.)
Related Product Information for anti-SEPT1 antibody
This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis. This gene encodes a protein associated with the tau-based paired helical filament core, and may contribute to the formation of neurofibrillary tangles in Alzheimer's disease. SEPT2, otherwise known as septin-2, is a cytoskeletal GTPase and member of the septin family, essential for the formation of filaments, in conjunction with SEPT6 and SEPT7. SEPT2 plays an important role during mitosis progression/cytokinesis, in the correct organization of the actin cytoskeleton, and maintains polyGlu microtubule tracks, thereby facilitating epithelial cell vesicle transport.
Product Categories/Family for anti-SEPT1 antibody
NCBI and Uniprot Product Information
NCBI Description
This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis and the maintenance of cellular morphology. This gene encodes a protein that can form homo- and heterooligomeric filaments, and may contribute to the formation of neurofibrillary tangles in Alzheimer's disease. Alternatively spliced transcript variants have been found but the full-length nature of these variants has not been determined. [provided by RefSeq, Dec 2012]
Research Articles on SEPT1
Similar Products
Product Notes
The SEPT1 (Catalog #AAA6160185) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SEPT1 (Septin-1, LARP, Peanut-like Protein 3, Serologically Defined Breast Cancer Antigen NY-BR-24, DIFF6, PNUTL3) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's 2019-09-01 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SEPT1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "2019-09-01, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
