Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.01kD).)

Mouse anti-Human 2019-03-06 Monoclonal Antibody | anti-MARCH6 antibody

MARCH6 (E3 Ubiquitin-protein Ligase MARCH6, Doa10 Homolog, Membrane-associated RING Finger Protein 6, Membrane-associated RING-CH Protein VI, MARCH-VI, Protein TEB-4, RING Finger Protein 176, KIAA0597, RNF176, TEB4) (FITC)

Gene Names
MARCHF6; TEB4; DOA10; FAME3; MARCH6; RNF176; MARCH-VI
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
2019-03-06; Monoclonal Antibody; MARCH6 (E3 Ubiquitin-protein Ligase MARCH6; Doa10 Homolog; Membrane-associated RING Finger Protein 6; Membrane-associated RING-CH Protein VI; MARCH-VI; Protein TEB-4; RING Finger Protein 176; KIAA0597; RNF176; TEB4) (FITC); anti-MARCH6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F7
Specificity
Recognizes human MARCH6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
9641
Applicable Applications for anti-MARCH6 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2-91 from MARCH6 (NP_005876) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DTAEEDICRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRFAFTPIYSPDMPSRLPIQDIFAGLVTSIGTAIR
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.01kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.01kD).)

Testing Data

(Detection limit for recombinant GST tagged MARCH6 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MARCH6 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-MARCH6 antibody
MARCH6 (Membrane associated RING finger protein 6) belongs to the MARCH family, which contains at least seven membrane associated RING-CH (MARCH)proteins. MARCH proteins are E3 ubiquitin ligases and are located to subcellular membranes.
Product Categories/Family for anti-MARCH6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens membrane associated ring-CH-type finger 6 (MARCHF6), transcript variant 1, mRNA
NCBI Official Synonym Full Names
membrane associated ring-CH-type finger 6
NCBI Official Symbol
MARCHF6
NCBI Official Synonym Symbols
TEB4; DOA10; FAME3; MARCH6; RNF176; MARCH-VI
NCBI Protein Information
E3 ubiquitin-protein ligase MARCH6
UniProt Protein Name
E3 ubiquitin-protein ligase MARCH6
UniProt Gene Name
MARCH6
UniProt Synonym Gene Names
KIAA0597; RNF176; TEB4; MARCH-VI
UniProt Entry Name
MARH6_HUMAN

NCBI Description

This gene encodes a member of a family of membrane-associated E3 ubiquitin ligases containing RING-CH-type zinc finger motifs. Ubiquitination of type II deiodinase by the encoded protein is an important regulatory step in thyroid hormone signalling. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]

Uniprot Description

MARCH6: E3 ubiquitin-protein ligase that promotes ubiquitination of DIO2, leading to its degradation. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. May cooperate with UBE2G1.

Protein type: Membrane protein, multi-pass; Ubiquitin conjugating system; Membrane protein, integral; Ubiquitin ligase; EC 6.3.2.19; EC 6.3.2.-; Ligase

Chromosomal Location of Human Ortholog: 5p15.2

Cellular Component: membrane; integral to endoplasmic reticulum membrane

Molecular Function: enzyme binding; ubiquitin conjugating enzyme binding; zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Research Articles on MARCH6

Similar Products

Product Notes

The MARCH6 march6 (Catalog #AAA6148135) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MARCH6 (E3 Ubiquitin-protein Ligase MARCH6, Doa10 Homolog, Membrane-associated RING Finger Protein 6, Membrane-associated RING-CH Protein VI, MARCH-VI, Protein TEB-4, RING Finger Protein 176, KIAA0597, RNF176, TEB4) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's 2019-03-06 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MARCH6 march6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "2019-03-06, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.