Mouse anti-Human 2019-03-02 Monoclonal Antibody | anti-MARCH2 antibody

MARCH2 (E3 Ubiquitin-protein Ligase MARCH2, Membrane-associated RING Finger Protein 2, Membrane-associated RING-CH Protein II, MARCH-II, RING Finger Protein 172, RNF172, HSPC240) (MaxLight 405)

Cat. Num. AAA6191086

• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: 2019-03-02; Monoclonal Antibody; MARCH2 (E3 Ubiquitin-protein Ligase MARCH2; Membrane-associated RING Finger Protein 2; Membrane-associated RING-CH Protein II; MARCH-II; RING Finger Protein 172; RNF172; HSPC240) (MaxLight 405); anti-MARCH2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 7F3
• Specificity: Recognizes human MARCH2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
• Sequence Length: 176

• Applicable Applications for anti-MARCH2 antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant protein corresponding to aa1-176 from human MARCH2 with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV
• Conjugate: MaxLight405
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MARCH2 expression in transfected 293T cell line using MBS642994. Lane 1: MARCH2 transfected lysate (19.1kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-MARCH2 antibody

MARCH2 is an E3 ubiquitin ligase. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. MARCH2 may mediate ubiquitination of TFRC and CD86, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies.

Product Categories/Family for anti-MARCH2 antibody

Antibodies; Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 53729334
• NCBI Accession #: NP_001005416.1
• NCBI GenBank Nucleotide #: NM_001005416
• UniProt Accession #: Q9P0N8
• NCBI Official Full Name: E3 ubiquitin-protein ligase MARCH2 isoform 2
• UniProt Protein Name: E3 ubiquitin-protein ligase MARCH2
• UniProt Gene Name: MARCH2
• UniProt Synonym Gene Names: RNF172; MARCH-II
• UniProt Entry Name: MARH2_HUMAN

Uniprot Description

MARCH2: E3 ubiquitin-protein ligase that may mediate ubiquitination of TFRC and CD86, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin- conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. May be involved in endosomal trafficking through interaction with STX6. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 6.3.2.19; Ligase; Ubiquitin ligase; Membrane protein, multi-pass; EC 6.3.2.-; Membrane protein, integral; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: endoplasmic reticulum membrane; lysosomal membrane; endoplasmic reticulum; integral to membrane; endosome membrane; cytoplasmic vesicle

Molecular Function: zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: protein ubiquitination; endocytosis