Interstitial collagenase (MMP1) Recombinant Protein | MMP1 recombinant protein

Recombinant Human Interstitial collagenase (MMP1), partial

Cat. Num. AAA1265580

• Gene Names: MMP1; CLG; CLGN
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interstitial collagenase (MMP1); Recombinant Human Interstitial collagenase (MMP1); partial; Fibroblast collagenase; Matrix metalloproteinase-1 ; MMP-1; MMP1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 101-469aa, Partial
• Sequence: VLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN

• Species: Homo sapiens (Human)
• Subcellular Location: Secreted, extracellular space, extracellular matrix
• Protein Families: Peptidase M10A family
• Pathway: PPAR signaling pathway
• Relevance: Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X. In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity.
• Function: Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

Product Categories/Family for MMP1 recombinant protein

Developmental Biology

References

Cloning and characterization of human tumor cell interstitial collagenase.Templeton N.S., Brown P.D., Levy A.T., Margulies I.M.K., Liotta L.A., Stetler-Stevenson W.G.Cancer Res. 50:5431-5437(1990)
https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:7155
https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=83169
https://www.genome.jp/dbget-bin/www_bget?hsa:4312
https://string-db.org/network/9606.ENSP00000322788
https://www.omim.org/entry/120353120353120353

NCBI and Uniprot Product Information

• NCBI GI #: 4505215
• NCBI GeneID: 4312
• NCBI Accession #: NP_002412.1
• NCBI GenBank Nucleotide #: NM_002421.3
• UniProt Accession #: P03956; P08156
• Molecular Weight: 54,007 Da
• NCBI Official Full Name: interstitial collagenase isoform 1 preproprotein
• NCBI Official Synonym Full Names: matrix metallopeptidase 1 (interstitial collagenase)
• NCBI Official Symbol: MMP1
• NCBI Official Synonym Symbols: CLG; CLGN
• NCBI Protein Information: interstitial collagenase; fibroblast collagenase; matrix metalloprotease 1; matrix metalloproteinase 1
• UniProt Protein Name: Interstitial collagenase
• Protein Family: Interstitial collagenase
• UniProt Gene Name: MMP1
• UniProt Synonym Gene Names: CLG; MMP-1
• UniProt Entry Name: MMP1_HUMAN

NCBI Description

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes a secreted enzyme which breaks down the interstitial collagens, types I, II, and III. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009]

Uniprot Description

MMP1: Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X. In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity. Belongs to the peptidase M10A family.

Protein type: Protease; Secreted, signal peptide; EC 3.4.24.7; Motility/polarity/chemotaxis; Secreted

Chromosomal Location of Human Ortholog: 11q22.3

Cellular Component: proteinaceous extracellular matrix; extracellular region

Molecular Function: zinc ion binding; metalloendopeptidase activity; endopeptidase activity; calcium ion binding

Biological Process: positive regulation of protein oligomerization; extracellular matrix disassembly; collagen catabolic process; extracellular matrix organization and biogenesis; cellular protein metabolic process; viral reproduction; blood coagulation; proteolysis; leukocyte migration

Disease: Epidermolysis Bullosa Dystrophica, Autosomal Recessive; Pulmonary Disease, Chronic Obstructive