Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Monocyte to macrophage differentiation factor 2 (Mmd2) Recombinant Protein | Mmd2 recombinant protein

Recombinant Mouse Monocyte to macrophage differentiation factor 2 (Mmd2)

Gene Names
Mmd2; C88001; 4930518M15Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Monocyte to macrophage differentiation factor 2 (Mmd2); Recombinant Mouse Monocyte to macrophage differentiation factor 2 (Mmd2); Mmd2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-247aa; full length protein
Sequence
MFTLARLLDFQKTKYARFMNDRVPAHKRYQPTEYEHAANCATHAFWIIPSILGSSNLYFL SDDDWETISAWIYGLGLCGLFVVSTIFHTVSWKKSHLRMVEHCLHMIDRMVIYFFIAASY APWLNLRELGPWASHMRWLVWIMASIGTIYVFFFHERYKLVELLCYVVMGFFPALVILSM PNTDGIWELMTGGAFYCLGMVFFKSDGRIPFAHAIWHLFVAFGAGTHYYAIWRYLYLPST LQTKVSK
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Mmd2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,910 Da
NCBI Official Full Name
monocyte to macrophage differentiation factor 2
NCBI Official Synonym Full Names
monocyte to macrophage differentiation-associated 2
NCBI Official Symbol
Mmd2
NCBI Official Synonym Symbols
C88001; 4930518M15Rik
NCBI Protein Information
monocyte to macrophage differentiation factor 2
UniProt Protein Name
Monocyte to macrophage differentiation factor 2
UniProt Gene Name
Mmd2
UniProt Synonym Gene Names
Paqr10
UniProt Entry Name
PAQRA_MOUSE

Uniprot Description

MMD2: a member of the PAQR (progestin and adipoQ receptor) family. Members of this family are evolutionarily conserved with significant sequence identity to bacterial hemolysin-like proteins and are defined by a set of seven transmembrane domains. The protein encoded by this gene localizes to the Golgi apparatus to modulate Ras signaling. Alternative splicing results in multiple transcript variants and protein isoforms. [provided by RefSeq, Jun 2012]

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Cellular Component: Golgi apparatus; integral to membrane; membrane; perinuclear region of cytoplasm

Molecular Function: protein kinase activity

Biological Process: cytolysis; positive regulation of neuron differentiation; positive regulation of protein kinase activity; positive regulation of Ras protein signal transduction; protein amino acid phosphorylation; regulation of protein localization

Research Articles on Mmd2

Similar Products

Product Notes

The Mmd2 mmd2 (Catalog #AAA7020395) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-247aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Mmd2 mmd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MFTLARLLDF QKTKYARFMN DRVPAHKRYQ PTEYEHAANC ATHAFWIIPS ILGSSNLYFL SDDDWETISA WIYGLGLCGL FVVSTIFHTV SWKKSHLRMV EHCLHMIDRM VIYFFIAASY APWLNLRELG PWASHMRWLV WIMASIGTIY VFFFHERYKL VELLCYVVMG FFPALVILSM PNTDGIWELM TGGAFYCLGM VFFKSDGRIP FAHAIWHLFV AFGAGTHYYA IWRYLYLPST LQTKVSK. It is sometimes possible for the material contained within the vial of "Monocyte to macrophage differentiation factor 2 (Mmd2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.