Probable E3 ubiquitin-protein ligase makorin-2 (MKRN2) Recombinant Protein | MKRN2 recombinant protein

Recombinant Human Probable E3 ubiquitin-protein ligase makorin-2 (MKRN2)

Cat. Num. AAA1330205

• Gene Names: MKRN2; RNF62; HSPC070
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Probable E3 ubiquitin-protein ligase makorin-2 (MKRN2); Recombinant Human Probable E3 ubiquitin-protein ligase makorin-2 (MKRN2); MKRN2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-416, Full length protein
• Sequence: MSTKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRCRYDHTRPSAAAGGAVGTMAHSVPSPAFHSPHPPSEVTASIVKTNSHEPGKREKRTLVLRDRNLSGMAERKTQPSMVSNPGSCSDPQPSPEMKPHSYLDAIRSGLDDVEASSSYSNEQQLCPYAAAGECRFGDACVYLHGEVCEICRLQVLHPFDPEQRKAHEKICMLTFEHEMEKAFAFQASQDKVCSICMEVILEKASASERRFGILSNCNHTYCLSCIRQWRCAKQFENPIIKSCPECRVISEFVIPSVYWVEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESSEP
• Sequence Length: 416

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 411147393
• NCBI GeneID: 23609
• NCBI Accession #: NP_001258636.1
• NCBI GenBank Nucleotide #: NM_001271707.1
• UniProt Accession #: Q9H000; Q8N391; Q96BD4; Q9BUY2; Q9NRY1; A6NIA2; B3KRC5; B4DPR4
• Molecular Weight: 41,985 Da
• NCBI Official Full Name: probable E3 ubiquitin-protein ligase makorin-2 isoform 2
• NCBI Official Synonym Full Names: makorin ring finger protein 2
• NCBI Official Symbol: MKRN2
• NCBI Official Synonym Symbols: RNF62; HSPC070
• NCBI Protein Information: probable E3 ubiquitin-protein ligase makorin-2
• UniProt Protein Name: Probable E3 ubiquitin-protein ligase makorin-2
• Protein Family: Probable E3 ubiquitin-protein ligase makorin
• UniProt Gene Name: MKRN2
• UniProt Synonym Gene Names: RNF62

NCBI Description

This gene encodes a probable E3 ubiquitin ligase containing several zinc finger domains, that is a member of the makorin RING zinc-finger protein family. This gene overlaps the v-raf-1 murine leukemia viral oncogene homolog 1 (RAF1) gene in an antisense orientation and may have a co-regulatory function with RAF1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012]

Uniprot Description

E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins.