Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Lens fiber major intrinsic protein (MIP) Recombinant Protein | MIP recombinant protein

Recombinant Dog Lens fiber major intrinsic protein (MIP)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lens fiber major intrinsic protein (MIP); Recombinant Dog Lens fiber major intrinsic protein (MIP); MIP recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-263
Sequence
MWELRSASFWRAIFAEFFATLFYVFFGLGASLRWTPGPLHVLQVALAFGLALATLVQAVGHISGAHVNPAVTFAFLVGSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHPGVSVGQATTVEIFLTLQFVLCIFATYDERRNGRLGSVALAVGFSLTLGHLFGMYYTGAGMNPARSFAPAILTRNFTNHWVYWVGPIIGGGLGSLLYDFLLFPRLKSVSERLSILKGARPSDSNGQPEGTGEPVELKTQAL
Sequence Length
263
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for MIP recombinant protein
MIP; AQP0

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,233 Da
NCBI Official Full Name
lens fiber major intrinsic protein
NCBI Official Symbol
MIP
NCBI Protein Information
lens fiber major intrinsic protein; aquaporin; aquaporin-0
UniProt Protein Name
Lens fiber major intrinsic protein
UniProt Gene Name
MIP
UniProt Synonym Gene Names
AQP0
UniProt Entry Name
MIP_CANFA

Uniprot Description

Function: Water channel. May be responsible for regulating the osmolarity of the lens. Interactions between homotetramers from adjoining membranes may stabilize cell junctions in the eye lens core

By similarity.

Subunit structure: Homotetramer. Homooctamer formed by head-to-head interaction between homotetramers from adjoining membranes

By similarity.

Subcellular location: Membrane; Multi-pass membrane protein

By similarity. Cell junction › gap junction

By similarity.

Domain: Aquaporins contain two tandem repeats each containing two membrane-spanning helices and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA). Each tandem repeat contains a loop and a short helix that enter and leave the lipid bilayer on the same side

By similarity.

Post-translational modification: Subject to partial proteolytic cleavage in the eye lens core. Partial proteolysis promotes interactions between tetramers from adjoining membranes

By similarity.

Sequence similarities: Belongs to the MIP/aquaporin (TC 1.A.8) family. [View classification]

Similar Products

Product Notes

The MIP mip (Catalog #AAA1041077) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-263. The amino acid sequence is listed below: MWELRSASFW RAIFAEFFAT LFYVFFGLGA SLRWTPGPLH VLQVALAFGL ALATLVQAVG HISGAHVNPA VTFAFLVGSQ MSLLRAFCYM AAQLLGAVAG AAVLYSVTPP AVRGNLALNT LHPGVSVGQA TTVEIFLTLQ FVLCIFATYD ERRNGRLGSV ALAVGFSLTL GHLFGMYYTG AGMNPARSFA PAILTRNFTN HWVYWVGPII GGGLGSLLYD FLLFPRLKSV SERLSILKGA RPSDSNGQPE GTGEPVELKT QAL. It is sometimes possible for the material contained within the vial of "Lens fiber major intrinsic protein (MIP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.