Probable monogalactosyldiacylglycerol synthase 3, chloroplastic (MGD3) Recombinant Protein | MGD3 recombinant protein

Recombinant Oryza sativa subsp. japonica Probable monogalactosyldiacylglycerol synthase 3, chloroplastic (MGD3)

Gene Names

LOC4331045; MGD3; OsMGD3; OsJ_008461

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

Probable monogalactosyldiacylglycerol synthase 3; chloroplastic (MGD3); Recombinant Oryza sativa subsp. japonica Probable monogalactosyldiacylglycerol synthase 3; MGD3 recombinant protein

Ordering
Cat. Num. AAA1386696 When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures. For Research Use Only!

Host

E Coli or Yeast or Baculovirus or Mammalian Cell

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Lyophilized or liquid (Format to be determined during the manufacturing process)

Sequence Positions

61-508, Full length protein

Sequence

GASSSASTTSLCGPDEDDEPFWEEEEGTVELVQLGANRAKNVLILMSDTGGGHRASAQAIKDPFRIEFGDDYRVFVKDLCKDHAGWPLNNMESSYKFMVKHVQLWKVAFHTTSPRWVHCFYLAALASFYAKKVEAGLKKYKPDIIISVHPLMQHIPLWVLKWQGLQNRVVFVTVITDLNTCHPTWFHADVNRCYCPSEEVAKRAALDDLQPSQIRVFGLPIRPSFCRAVLVKDDLRKELELDPELPAVLLMGGGEGMGPVKKTAKALGESLFDKELGKPIGQLIVICGRNKTLSSSLQALEWKIPIKVRGFETQMEKWMGACDCIITKAGPGTIAEALIRGLPIILNDFIPGQEVGNVPYVVDNGAGVFSKSSRETAKLVARWFGPDSDELKRMSEKALKLAQPEAVFDIVRDIHELSREQGVISQISSSLTSSFFIPSPETTPIQLM

Sequence Length

448

Species

Oryza sativa subsp. japonica (Rice)

Preparation and Storage

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #

205815293

NCBI GeneID

4331045

UniProt Accession #

Q0DWQ1; Q69SK2; A3ACD9

Molecular Weight

56,243 Da

NCBI Official Full Name

Probable monogalactosyldiacylglycerol synthase 3, chloroplastic

NCBI Official Symbol

LOC4331045

NCBI Official Synonym Symbols

MGD3; OsMGD3; OsJ_008461

NCBI Protein Information

probable monogalactosyldiacylglycerol synthase 3, chloroplastic

UniProt Protein Name

Probable monogalactosyldiacylglycerol synthase 3, chloroplastic

Protein Family

Probable monogalactosyldiacylglycerol synthase

UniProt Gene Name

MGD3

UniProt Synonym Gene Names

OsMGD3

Uniprot Description

Involved in the synthesis of the major structural component of photosynthetic membranes.

Similar Products

Product Notes

The MGD3 mgd3 (Catalog #AAA1386696) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 61-508, Full length protein. The amino acid sequence is listed below: GASSSASTTS LCGPDEDDEP FWEEEEGTVE LVQLGANRAK NVLILMSDTG GGHRASAQAI KDPFRIEFGD DYRVFVKDLC KDHAGWPLNN MESSYKFMVK HVQLWKVAFH TTSPRWVHCF YLAALASFYA KKVEAGLKKY KPDIIISVHP LMQHIPLWVL KWQGLQNRVV FVTVITDLNT CHPTWFHADV NRCYCPSEEV AKRAALDDLQ PSQIRVFGLP IRPSFCRAVL VKDDLRKELE LDPELPAVLL MGGGEGMGPV KKTAKALGES LFDKELGKPI GQLIVICGRN KTLSSSLQAL EWKIPIKVRG FETQMEKWMG ACDCIITKAG PGTIAEALIR GLPIILNDFI PGQEVGNVPY VVDNGAGVFS KSSRETAKLV ARWFGPDSDE LKRMSEKALK LAQPEAVFDI VRDIHELSRE QGVISQISSS LTSSFFIPSP ETTPIQLM. It is sometimes possible for the material contained within the vial of "Probable monogalactosyldiacylglycerol synthase 3, chloroplastic (MGD3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...