Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mitofusin-2 (Mfn2) Recombinant Protein | Mfn2 recombinant protein

Recombinant Rat Mitofusin-2 (Mfn2)

Gene Names
Mfn2; HSG
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitofusin-2 (Mfn2); Recombinant Rat Mitofusin-2 (Mfn2); Mfn2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-757aa; full length protein
Sequence
MSLLFSRCNSIVTVKKDKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESAGFLEDT HRNTELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDK VLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAGSLVS VMWPNSKCPLLKDGLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQF FHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDR IFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECISQSAVKTKFEQ HTVRAKQIAEAVRLIMDSLHIAAQEQRVYCLEMREERQDRLRFIDKQLELLAQDYKLRIK QMTEEVERQVSTAMAEEIRRLSVLVDEYQMDFHPSPVVLKVYKNELHRHIEEGLGRNMSD RCSTAIASSLQTMQQDMIDGLKPLLPVSVRNQIDMLVPRQCFSLSYDLNCDKLCADFQED IEFHFSLGWTMLVNRFLGPKNSRRALLGYNDQVQRPLPLTPANPSMPPLPQGSLTQEELM VSMVTGLASLTSRTSMGILVVGGVVWKAVGWRLIALSFGLYGLLYVYERLTWTTRAKERA FKRQFVEYASEKLQLIISYTGSNCSHQVQQELSGTFAHLCQQVDITRDNLEQEIAAMNKK VEALDSLQSKAKLLRNKAGWLDSELNMFIHQYLQPSR
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Mfn2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
86,123 Da
NCBI Official Full Name
Mitofusin-2
NCBI Official Synonym Full Names
mitofusin 2
NCBI Official Symbol
Mfn2
NCBI Official Synonym Symbols
HSG
NCBI Protein Information
mitofusin-2
UniProt Protein Name
Mitofusin-2
Protein Family
UniProt Gene Name
Mfn2
UniProt Synonym Gene Names
Fzo1a; Protein HSG
UniProt Entry Name
MFN2_RAT

Uniprot Description

MFN2: Essential transmembrane GTPase, which mediates mitochondrial fusion. Fusion of mitochondria occurs in many cell types and constitutes an important step in mitochondria morphology, which is balanced between fusion and fission. MFN2 acts independently of the cytoskeleton. It therefore plays a central role in mitochondrial metabolism and may be associated with obesity and/or apoptosis processes. Overexpression induces the formation of mitochondrial networks. Plays an important role in the regulation of vascular smooth muscle cell proliferation. Defects in MFN2 are the cause of Charcot-Marie-Tooth disease type 2A2 (CMT2A2). CMT2A2 is a form of Charcot-Marie-Tooth disease, the most common inherited disorder of the peripheral nervous system. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathy or CMT1, and primary peripheral axonal neuropathy or CMT2. Neuropathies of the CMT2 group are characterized by signs of axonal regeneration in the absence of obvious myelin alterations, normal or slightly reduced nerve conduction velocities, and progressive distal muscle weakness and atrophy. Defects in MFN2 are the cause of Charcot-Marie-Tooth disease type 6 (CMT6); also referred to as autosomal dominant hereditary motor and sensory neuropathy VI (HMSN6). CMT6 is an autosomal dominant form of axonal CMT associated with optic atrophy. Belongs to the mitofusin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.6.5.-; Cytoskeletal; Hydrolase; Mitochondrial; Cell cycle regulation; Membrane protein, multi-pass; Membrane protein, integral

Cellular Component: cytosol; integral to membrane; intrinsic to mitochondrial outer membrane; microtubule cytoskeleton; mitochondrial outer membrane; mitochondrion

Molecular Function: GTP binding; GTPase activity; GTPase binding; ubiquitin protein ligase binding

Biological Process: apoptosis; autophagy; blastocyst formation; camera-type eye morphogenesis; cell cycle arrest; mitochondrial fusion; mitochondrial membrane organization and biogenesis; mitochondrion localization; negative regulation of cell proliferation; negative regulation of Ras protein signal transduction; negative regulation of smooth muscle cell proliferation; protein targeting to mitochondrion; response to unfolded protein

Research Articles on Mfn2

Similar Products

Product Notes

The Mfn2 mfn2 (Catalog #AAA7020279) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-757aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Mfn2 mfn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSLLFSRCNS IVTVKKDKRH MAEVNASPLK HFVTAKKKIN GIFEQLGAYI QESAGFLEDT HRNTELDPVT TEEQVLDVKG YLSKVRGISE VLARRHMKVA FFGRTSNGKS TVINAMLWDK VLPSGIGHTT NCFLRVGGTD GHEAFLLTEG SEEKKSVKTV NQLAHALHQD EQLHAGSLVS VMWPNSKCPL LKDGLVLMDS PGIDVTTELD SWIDKFCLDA DVFVLVANSE STLMQTEKQF FHKVSERLSR PNIFILNNRW DASASEPEYM EEVRRQHMER CTSFLVDELG VVDRAQAGDR IFFVSAKEVL SARVQKAQGM PEGGGALAEG FQVRMFEFQN FERRFEECIS QSAVKTKFEQ HTVRAKQIAE AVRLIMDSLH IAAQEQRVYC LEMREERQDR LRFIDKQLEL LAQDYKLRIK QMTEEVERQV STAMAEEIRR LSVLVDEYQM DFHPSPVVLK VYKNELHRHI EEGLGRNMSD RCSTAIASSL QTMQQDMIDG LKPLLPVSVR NQIDMLVPRQ CFSLSYDLNC DKLCADFQED IEFHFSLGWT MLVNRFLGPK NSRRALLGYN DQVQRPLPLT PANPSMPPLP QGSLTQEELM VSMVTGLASL TSRTSMGILV VGGVVWKAVG WRLIALSFGL YGLLYVYERL TWTTRAKERA FKRQFVEYAS EKLQLIISYT GSNCSHQVQQ ELSGTFAHLC QQVDITRDNL EQEIAAMNKK VEALDSLQSK AKLLRNKAGW LDSELNMFIH QYLQPSR. It is sometimes possible for the material contained within the vial of "Mitofusin-2 (Mfn2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.