Maternal embryonic leucine zipper kinase (MELK) Recombinant Protein | MELK recombinant protein

Recombinant Human Maternal embryonic leucine zipper kinase (MELK), partial

Cat. Num. AAA7136942

• Gene Names: MELK; HPK38
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Maternal embryonic leucine zipper kinase (MELK); Recombinant Human Maternal embryonic leucine zipper kinase (MELK); partial; Maternal embryonic leucine zipper kinase (EC:2.7.11.1) ; hMELK; Protein kinase Eg3; pEg3 kinase; Protein kinase PK38; hPK38; Tyrosine-protein kinase MELK; MELK recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process); If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.; If the delivery form is lyophilized powder, the buffer before lyop
• Sequence Positions: 1-340aa, Partial
• Sequence: MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCG

• Species: Human
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Function: Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622. Acts as an activator of apoptosis by phosphorylating and activating MAP3K5/ASK1. Acts as a regulator of cell cycle, notably by mediating phosphorylation of CDC25B, promoting localization of CDC25B to the centrosome and the spindle poles during mitosis. Plays a key role in cell proliferation and carcinogenesis. Required for proliferation of embryonic and postnatal multipotent neural progenitors. Phosphorylates and inhibits BCL2L14, possibly leading to affect mammary carcinogenesis by mediating inhibition of the pro-apoptotic function of BCL2L14. Also involved in the inhibition of spliceosome assembly during mitosis by phosphorylating ZNF622, thereby contributing to its redirection to the nucleus. May also play a role in primitive hematopoiesis.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Product Categories/Family for MELK recombinant protein

Cell Biology

References

"Involvement of maternal embryonic leucine zipper kinase (MELK) in mammary carcinogenesis through interaction with Bcl-G, a pro-apoptotic member of the Bcl-2 family."Lin M.L., Park J.H., Nishidate T., Nakamura Y., Katagiri T.Breast Cancer Res. 9:R17-R17 (2007)

NCBI and Uniprot Product Information

• NCBI GI #: 375493532
• NCBI GeneID: 9833
• NCBI Accession #: NP_001243614.1
• NCBI GenBank Nucleotide #: NM_001256685.1
• UniProt Accession #: Q14680; Q7L3C3; A6P3A7; A6P3A8; B1AMQ6; B7Z1E6; B7Z6R8; B7Z6Y0; B7Z7Q1; D3DRP8; F5H2R4
• Molecular Weight: 74,642 Da
• NCBI Official Full Name: maternal embryonic leucine zipper kinase isoform 2
• NCBI Official Synonym Full Names: maternal embryonic leucine zipper kinase
• NCBI Official Symbol: MELK
• NCBI Official Synonym Symbols: HPK38
• NCBI Protein Information: maternal embryonic leucine zipper kinase; pEg3 kinase; protein kinase Eg3; protein kinase PK38; tyrosine-protein kinase MELK
• UniProt Protein Name: Maternal embryonic leucine zipper kinase
• Protein Family: Maternal embryonic leucine zipper kinase
• UniProt Gene Name: MELK
• UniProt Synonym Gene Names: KIAA0175; hMELK; pEg3 kinase; hPK38
• UniProt Entry Name: MELK_HUMAN

Uniprot Description

MELK: Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622. Acts as an activator of apoptosis by phosphorylating and activating MAP3K5/ASK1. Acts as a regulator of cell cycle, notably by mediating phosphorylation of CDC25B, promoting localization of CDC25B to the centrosome and the spindle poles during mitosis. Plays a key role in cell proliferation and carcinogenesis. Required for proliferation of embryonic and postnatal multipotent neural progenitors. Phosphorylates and inhibits BCL2L14, possibly leading to affect mammary carcinogenesis by mediating inhibition of the pro-apoptotic function of BCL2L14. Also involved in the inhibition of spliceosome assembly during mitosis by phosphorylating ZNF622, thereby contributing to its redirection to the nucleus. May also play a role in primitive hematopoiesis. Monomer. Interacts with ZNF622 and PPP1R8. Up-regulated in many cancers cells. Up-regulated upon treatment with radiation or 5-fluorouracil (5-FU) in colorectal cancer cells, suggesting that it might be associated with increased resistance of colorectal cells against radiation and 5- FU. Down-regulated upon siomycin A, a thiazole antibiotic, treatment, leading to inhibit tumor growth in vivo. Expressed in placenta, kidney, thymus, testis, ovary and intestine. Activated by autophosphorylation of the T-loop at Thr-167 and Ser-171: in contrast to other members of the SNF1 subfamily, phosphorylation at Thr-167 is not mediated by STK11/LKB1 but via autophosphorylation instead. Inhibited by calcium-binding. Kinase activity is also regulated by reducing agents: dithiothreitol (DTT) or reduced glutathione are required for kinase activity in vitro; such dependence is however not due to the presence of disulfide bonds. Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. SNF1 subfamily.

Protein type: Kinase, protein; EC 2.7.10.2; EC 2.7.11.1; RNA splicing; Protein kinase, Ser/Thr (non-receptor); Protein kinase, CAMK; CAMK group; CAMKL family; MELK subfamily

Chromosomal Location of Human Ortholog: 9p13.2

Cellular Component: membrane; plasma membrane; cell cortex

Molecular Function: protein serine/threonine kinase activity; protein binding; non-membrane spanning protein tyrosine kinase activity; calcium ion binding; lipid binding; ATP binding

Biological Process: cell proliferation; peptidyl-tyrosine phosphorylation; apoptosis; positive regulation of apoptosis; protein amino acid autophosphorylation; hemopoiesis; G2/M transition of mitotic cell cycle; induction of apoptosis by oxidative stress