Melatonin receptor type 1B Recombinant Protein | MTNR1B recombinant protein
Recombinant Chicken Melatonin receptor type 1B
Gene Names
MTNR1B; Mel-1B-R
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Melatonin receptor type 1B; Recombinant Chicken Melatonin receptor type 1B; Recombinant Melatonin receptor type 1B; Mel-1B-R; Mel1b receptor; MTNR1B recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-289
Sequence
GNAFVVSLALADLVVALYPYPLVLLAIFHNGWTLGEMHCKVSGFVMGLSVIGSIFNITAIAINRYCYICHSFAYDKVYSCWNTMLYVSLIWVLTVIATVPNFFVGSLKYDPRIYSCTFVQTASSYYTIAVVVIHFIVPITVVSFCYLRIWVLVLQVRRRVKSETKPRLKPSDFRNFLTMFVVFVIFAFCWAPLNFIGLAVAINPSEMAPKVPEWLFIISYFMAYFNSCLNAIIYGLLNQNFRNEYKRILMSLWMPRLFFQDTSKGGTDGQKSKPSPALNNNDQMKTDTL
Sequence Length
289
Species
Gallus gallus (Chicken)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
33,001 Da
NCBI Official Full Name
Melatonin receptor type 1B
NCBI Official Synonym Full Names
melatonin receptor 1B
NCBI Official Symbol
MTNR1B
NCBI Official Synonym Symbols
Mel-1B-R
NCBI Protein Information
melatonin receptor type 1B; melatonin receptor 1B; mel1b receptor; Mel-1b melatonin receptor
UniProt Protein Name
Melatonin receptor type 1B
Protein Family
UniProt Gene Name
Mel-1B-R
UniProt Synonym Gene Names
Mel-1B-R
UniProt Entry Name
MTR1B_CHICK
Uniprot Description
Function: High affinity receptor for melatonin. The activity of this receptor is mediated by pertussis toxin sensitive G proteins that inhibits adenylate cyclase activity
By similarity.
Subcellular location: Cell membrane; Multi-pass membrane protein.
Tissue specificity: Brain and kidney, with trace levels in lungs.
Sequence similarities: Belongs to the G-protein coupled receptor 1 family.
Similar Products
Product Notes
The MTNR1B mel-1b-r (Catalog #AAA1174951) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-289. The amino acid sequence is listed below: GNAFVVSLAL ADLVVALYPY PLVLLAIFHN GWTLGEMHCK VSGFVMGLSV IGSIFNITAI AINRYCYICH SFAYDKVYSC WNTMLYVSLI WVLTVIATVP NFFVGSLKYD PRIYSCTFVQ TASSYYTIAV VVIHFIVPIT VVSFCYLRIW VLVLQVRRRV KSETKPRLKP SDFRNFLTMF VVFVIFAFCW APLNFIGLAV AINPSEMAPK VPEWLFIISY FMAYFNSCLN AIIYGLLNQN FRNEYKRILM SLWMPRLFFQ DTSKGGTDGQ KSKPSPALNN NDQMKTDTL. It is sometimes possible for the material contained within the vial of "Melatonin receptor type 1B, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
