Mediator of RNA polymerase II transcription subunit 7 (med7) Recombinant Protein | med7 recombinant protein
Recombinant Danio rerio Mediator of RNA polymerase II transcription subunit 7 (med7)
Gene Names
med7; crsp9; zgc:56241; wu:fd99d12
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mediator of RNA polymerase II transcription subunit 7 (med7); Recombinant Danio rerio Mediator of RNA polymerase II transcription subunit 7 (med7); med7 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-241, Full length protein
Sequence
MGEPQQVSALPPPPMQYIKEYTDENVRKGLAPKPPPPIRDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKRELKKLNMSILVNFLDLLDILIKSPGSIKREEKLEDLKLLFVHMHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVVEMIQGCLSSLPDDLPLPNSSSMGEAGSAAGSSRLKTEPMDVDDVAGASCMVLQTDKNVPVKKDGVCDNDVVMCRIIDEMT
Sequence Length
241
Species
Zebrafish
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,519 Da
NCBI Official Full Name
mediator of RNA polymerase II transcription subunit 7
NCBI Official Synonym Full Names
mediator complex subunit 7
NCBI Official Symbol
med7
NCBI Official Synonym Symbols
crsp9; zgc:56241; wu:fd99d12
NCBI Protein Information
mediator of RNA polymerase II transcription subunit 7
UniProt Protein Name
Mediator of RNA polymerase II transcription subunit 7
Protein Family
UniProt Gene Name
med7
UniProt Synonym Gene Names
crsp9; CRSP complex subunit 9
Uniprot Description
Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors ().
Similar Products
Product Notes
The med7 med7 (Catalog #AAA1462074) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-241, Full length protein. The amino acid sequence is listed below: MGEPQQVSAL PPPPMQYIKE YTDENVRKGL APKPPPPIRD SYMMFGNQFQ CDDLIIRPLE SQGIERLHPM QFDHKRELKK LNMSILVNFL DLLDILIKSP GSIKREEKLE DLKLLFVHMH HLINEYRPHQ ARETLRVMME VQKRQRLETA ERFQKHLERV VEMIQGCLSS LPDDLPLPNS SSMGEAGSAA GSSRLKTEPM DVDDVAGASC MVLQTDKNVP VKKDGVCDND VVMCRIIDEM T. It is sometimes possible for the material contained within the vial of "Mediator of RNA polymerase II transcription subunit 7 (med7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
