Envelope glycoprotein E (MDV096) Recombinant Protein | MDV096 recombinant protein
Recombinant Gallid herpesvirus 2 Envelope glycoprotein E (MDV096)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Envelope glycoprotein E (MDV096); Recombinant Gallid herpesvirus 2 Envelope glycoprotein E (MDV096); MDV096 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-497aa; full length protein
Sequence
MCVFQILIIVTTIKVAGTANINHIDVPAGHSATTTIPRYPPVVDGTLYTETWTWIPNHCN ETATGYVCLESAHCFTDLILGVSCMRYADEIVLRTDKFIVDAGSIKQIESLSLNGVPNIF LSTKASNKLEILNASLQNAGIYIRYSRNGTRTAKLDVVVVGVLGQARDRLPQMSSPMISS HADIKLSLKNFKALVYHVGDTINVSTAVILGPSPEIFTLEFRVLFLRYNPTCKFVTIYEP CIFHPKEPECITTAEQSVCHFASNIDILQIAAARSENCSTGYRRCIYDTAIDESVQARLT FIEPGIPSFKMKDVQVDDAGLYVVVALYNGRPSAWTYIYLSTVETYLNVYENYHKPGFGY KSFLQNSSIVDENEASDWSSSSIKRRNNGTIIYDILLTSLSIGAIIIVIVGGVCIAILIR RRRRRRTRGLFDEYPKYMTLPGNDLGGMNVPYDNTCSGNQVEYYQEKSAKMKRMGSGYTA WLKNDMPKIRKRLDLYH
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) (GaHV-2) (Marek's disease herpesvirus type 1)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for MDV096 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
55,676 Da
NCBI Official Full Name
envelope glycoprotein E
NCBI Official Symbol
MDV096
NCBI Protein Information
type 1 membrane protein; contains a signal peptide; complexed with envelope glycoprotein I to form an Fc-receptor
UniProt Protein Name
Envelope glycoprotein E
UniProt Gene Name
MDV096
UniProt Synonym Gene Names
gE
UniProt Entry Name
GE_GAHVM
Uniprot Description
In epithelial cells, the heterodimer gE/gI is required for the cell-to-cell spread of the virus, by sorting nascent virions to cell junctions. Once the virus reaches the cell junctions, virus particles can spread to adjacent cells extremely rapidly through interactions with cellular receptors that accumulate at these junctions. Implicated in basolateral spread in polarized cells. In neuronal cells, gE/gI is essential for the anterograde spread of the infection throughout the host nervous system. Together with US9, the heterodimer gE/gI is involved in the sorting and transport of viral structural components toward axon tips ().
Similar Products
Product Notes
The MDV096 mdv096 (Catalog #AAA7020235) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-497aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the MDV096 mdv096 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MCVFQILIIV TTIKVAGTAN INHIDVPAGH SATTTIPRYP PVVDGTLYTE TWTWIPNHCN ETATGYVCLE SAHCFTDLIL GVSCMRYADE IVLRTDKFIV DAGSIKQIES LSLNGVPNIF LSTKASNKLE ILNASLQNAG IYIRYSRNGT RTAKLDVVVV GVLGQARDRL PQMSSPMISS HADIKLSLKN FKALVYHVGD TINVSTAVIL GPSPEIFTLE FRVLFLRYNP TCKFVTIYEP CIFHPKEPEC ITTAEQSVCH FASNIDILQI AAARSENCST GYRRCIYDTA IDESVQARLT FIEPGIPSFK MKDVQVDDAG LYVVVALYNG RPSAWTYIYL STVETYLNVY ENYHKPGFGY KSFLQNSSIV DENEASDWSS SSIKRRNNGT IIYDILLTSL SIGAIIIVIV GGVCIAILIR RRRRRRTRGL FDEYPKYMTL PGNDLGGMNV PYDNTCSGNQ VEYYQEKSAK MKRMGSGYTA WLKNDMPKIR KRLDLYH. It is sometimes possible for the material contained within the vial of "Envelope glycoprotein E (MDV096), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
