Multidrug resistance protein MdtG (mdtG) Recombinant Protein | mdtG recombinant protein
Recombinant Escherichia coli Multidrug resistance protein MdtG (mdtG), partial
Gene Names
mdtG; ECK1038; JW1040; yceE
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Multidrug resistance protein MdtG (mdtG); Recombinant Escherichia coli Multidrug resistance protein MdtG (mdtG); partial; mdtG recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-408
Sequence
MSPCENDTPINWKRNLIVAWLGCFLTGAAFSLVMPFLPLYVEQLGVTGHSALNMWSGIVFSITFLFSAIASPFWGGLADRKGRKLMLLRSALGMGIVMVLMGLAQNIWQFLILRALLGLLGGFVPNANALIATQVPRNKSGWALGTLSTGGVSGALLGPMAGGLLADSYGLRPVFFITASVLILCFFVTLFCIREKFQPVSKKEMLHMREVVTSLKNPKLVLSLFVTTLIIQVATGSIAPILTLYVRELAGNVSNVAFISGMIASVPGVAALLSAPRLGKLGDRIGPEKILITALIFSVLLLIPMSYVQTPLQLGILRFLLGAADGALLPAVQTLLVYNSSNQIAGRIFSYNQSFRDIGNVTGPLMGAAISANYGFRAVFLVTAGVVLFNAVYSWNSLRRRRIPQVSN
Sequence Length
408
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,867 Da
NCBI Official Full Name
putative drug efflux system protein
NCBI Official Symbol
mdtG
NCBI Official Synonym Symbols
ECK1038; JW1040; yceE
NCBI Protein Information
putative drug efflux system protein
UniProt Protein Name
Multidrug resistance protein MdtG
Protein Family
UniProt Gene Name
mdtG
UniProt Synonym Gene Names
yceE
NCBI Description
Major Facilitator Superfamily (MFS). [More information is available at EcoGene: EG11343]. The YceE protein is, based on sequence similarity and hydropathy, a member of the major facilitator superfamily (MFS) . [More information is available at EcoCyc: EG11343].
Uniprot Description
Confers resistance to fosfomycin and deoxycholate.
Research Articles on mdtG
Similar Products
Product Notes
The mdtG mdtg (Catalog #AAA1112109) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-408. The amino acid sequence is listed below: MSPCENDTPI NWKRNLIVAW LGCFLTGAAF SLVMPFLPLY VEQLGVTGHS ALNMWSGIVF SITFLFSAIA SPFWGGLADR KGRKLMLLRS ALGMGIVMVL MGLAQNIWQF LILRALLGLL GGFVPNANAL IATQVPRNKS GWALGTLSTG GVSGALLGPM AGGLLADSYG LRPVFFITAS VLILCFFVTL FCIREKFQPV SKKEMLHMRE VVTSLKNPKL VLSLFVTTLI IQVATGSIAP ILTLYVRELA GNVSNVAFIS GMIASVPGVA ALLSAPRLGK LGDRIGPEKI LITALIFSVL LLIPMSYVQT PLQLGILRFL LGAADGALLP AVQTLLVYNS SNQIAGRIFS YNQSFRDIGN VTGPLMGAAI SANYGFRAVF LVTAGVVLFN AVYSWNSLRR RRIPQVSN. It is sometimes possible for the material contained within the vial of "Multidrug resistance protein MdtG (mdtG), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
