Mitochondrial distribution and morphology protein 35 (MDM35) Recombinant Protein | MDM35 recombinant protein
Recombinant Saccharomyces cerevisiae Mitochondrial distribution and morphology protein 35 (MDM35)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitochondrial distribution and morphology protein 35 (MDM35); Recombinant Saccharomyces cerevisiae Mitochondrial distribution and morphology protein 35 (MDM35); MDM35 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-86, full length protein
Sequence
MGNIMSASFAPECTDLKTKYDSCFNEWYSEKFLKGKSVENECSKQWYAYTTCVNAALVKQGIKPALDEAREEAPFENGGKLKEVDK
Sequence Length
86
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
9,712 Da
NCBI Official Full Name
Mdm35p
NCBI Official Symbol
MDM35
NCBI Protein Information
Mdm35p
UniProt Protein Name
Mitochondrial distribution and morphology protein 35
Protein Family
UniProt Gene Name
MDM35
Uniprot Description
Involved in mitochondrial distribution and morphology. Mediates the import of UPS1, UPS2 and UPS3, 3 atypical mitochondrial intermembrane space (IMS) proteins lacking the two major IMS-targeting signals, into the intermembrane space. The UPS1:MDM35 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space (PubMed:26071602, PubMed:26071601, PubMed:26235513). Phosphatidic acid import is required for cardiolipin (CL) synthesis in the mitochondrial inner membrane (PubMed:26071602).
Research Articles on MDM35
Similar Products
Product Notes
The MDM35 mdm35 (Catalog #AAA1093524) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-86, full length protein. The amino acid sequence is listed below: MGNIMSASFA PECTDLKTKY DSCFNEWYSE KFLKGKSVEN ECSKQWYAYT TCVNAALVKQ GIKPALDEAR EEAPFENGGK LKEVDK. It is sometimes possible for the material contained within the vial of "Mitochondrial distribution and morphology protein 35 (MDM35), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
