Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mucolipin-1 (Mcoln1) Recombinant Protein | Mcoln1 recombinant protein

Recombinant Mouse Mucolipin-1 (Mcoln1)

Gene Names
Mcoln1; TRPML1; mucolipidin; 2210015I05Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mucolipin-1 (Mcoln1); Recombinant Mouse Mucolipin-1 (Mcoln1); Mcoln1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-580aa; full length protein
Sequence
MATPAGRRASETERLLTPNPGYGTQVGTSPAPTTPTEEEDLRRRLKYFFMSPCDKFRAKG RKPCKLMLQVVKILVVTVQLILFGLSNQLVVTFREENTIAFRHLFLLGYSDGSDDTFAAY TQEQLYQAIFYAVDQYLILPEISLGRYAYVRGGGGPWANGSALALCQRYYHRGHVDPAND TFDIDPRVVTDCIQVDPPDRPPDIPSEDLDFLDGSASYKNLTLKFHKLINVTIHFQLKTI NLQSLINNEIPDCYTFSILITFDNKAHSGRIPIRLETKTHIQECKHPSVSRHGDNSFRLL FDVVVILTCSLSFLLCARSLLRGFLLQNEFVVFMWRRRGREISLWERLEFVNGWYILLVT SDVLTISGTVMKIGIEAKNLASYDVCSILLGTSTLLVWVGVIRYLTFFHKYNILIATLRV ALPSVMRFCCCVAVIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVTFAAM QAQQGHSSLVWLFSQLYLYSFISLFIYMVLSLFIALITGAYDTIKHPGGTGTEKSELQAY IEQCQDSPTSGKFRRGSGSACSLFCCCGRDSPEDHSLLVN
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Mcoln1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69,853 Da
NCBI Official Full Name
mucolipin-1
NCBI Official Synonym Full Names
mucolipin 1
NCBI Official Symbol
Mcoln1
NCBI Official Synonym Symbols
TRPML1; mucolipidin; 2210015I05Rik
NCBI Protein Information
mucolipin-1
UniProt Protein Name
Mucolipin-1
Protein Family
UniProt Gene Name
Mcoln1
UniProt Entry Name
MCLN1_MOUSE

Uniprot Description

mucolipin 1: Cation channel probably playing a role in the endocytic pathway and in the control of membrane trafficking of proteins and lipids. Could play a major role in Ca(2+) transport regulating lysosomal exocytosis. Defects in MCOLN1 are the cause of mucolipidosis type IV (MLIV); also known as sialolipidosis. MLIV is an autosomal recessive lysosomal storage disorder characterized by severe psychomotor retardation and ophthalmologic abnormalities, including corneal opacity, retinal degeneration and strabismus. Storage bodies of lipids and water-soluble substances are seen by electron microscopy in almost every cell type of the patients. Most patients are unable to speak or walk independently and reach a maximal developmental level of 1-2 years. All patients have constitutive achlorhydia associated with a secondary elevation of serum gastrin levels. MLIV may be due to a defect in sorting and/or transport along the late endocytic pathway. MLIV is found at relatively high frequency among Ashkenazi Jews. Belongs to the transient receptor (TC 1.A.4) family. Polycystin subfamily. MCOLN1 sub-subfamily.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Transporter, ion channel; Channel, cation

Cellular Component: cytoplasm; endosome; integral to membrane; late endosome; lysosomal membrane; lysosome; membrane; plasma membrane; receptor complex

Molecular Function: cation channel activity

Biological Process: calcium ion transport; endosome transport; ion transport; release of sequestered calcium ion into cytosol; transport

Research Articles on Mcoln1

Similar Products

Product Notes

The Mcoln1 mcoln1 (Catalog #AAA7020013) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-580aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Mcoln1 mcoln1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MATPAGRRAS ETERLLTPNP GYGTQVGTSP APTTPTEEED LRRRLKYFFM SPCDKFRAKG RKPCKLMLQV VKILVVTVQL ILFGLSNQLV VTFREENTIA FRHLFLLGYS DGSDDTFAAY TQEQLYQAIF YAVDQYLILP EISLGRYAYV RGGGGPWANG SALALCQRYY HRGHVDPAND TFDIDPRVVT DCIQVDPPDR PPDIPSEDLD FLDGSASYKN LTLKFHKLIN VTIHFQLKTI NLQSLINNEI PDCYTFSILI TFDNKAHSGR IPIRLETKTH IQECKHPSVS RHGDNSFRLL FDVVVILTCS LSFLLCARSL LRGFLLQNEF VVFMWRRRGR EISLWERLEF VNGWYILLVT SDVLTISGTV MKIGIEAKNL ASYDVCSILL GTSTLLVWVG VIRYLTFFHK YNILIATLRV ALPSVMRFCC CVAVIYLGYC FCGWIVLGPY HVKFRSLSMV SECLFSLING DDMFVTFAAM QAQQGHSSLV WLFSQLYLYS FISLFIYMVL SLFIALITGA YDTIKHPGGT GTEKSELQAY IEQCQDSPTS GKFRRGSGSA CSLFCCCGRD SPEDHSLLVN. It is sometimes possible for the material contained within the vial of "Mucolipin-1 (Mcoln1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.