Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Melanin-concentrating hormone receptor 1 (Mchr1) Recombinant Protein | Mchr1 recombinant protein

Recombinant Rat Melanin-concentrating hormone receptor 1 (Mchr1)

Gene Names
Mchr1; Slc1; Gpr24; Mch-1r
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Melanin-concentrating hormone receptor 1 (Mchr1); Recombinant Rat Melanin-concentrating hormone receptor 1 (Mchr1); Recombinant Melanin-concentrating hormone receptor 1 (Mchr1); Melanin-concentrating hormone receptor 1; MCH receptor 1; MCH-R1; MCHR-1; G-protein coupled receptor 24 MCH-1R; MCH1R; MCHR SLC-1 Somatostatin receptor-like protein; Mchr1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-360
Sequence
QATCTGCMDLQTSLLSTGPNASNISDGQDNLTLPGSPPRTGSVSYINIIMPSVFGTICLLGIVGNSTVIFAVVKKSKLHWCSNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMTIDRYLATVHPISSTKFRKPSMATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVKILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRTVSNAQTADEERTESKGT
Sequence Length
360
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,728 Da
NCBI Official Full Name
melanin-concentrating hormone receptor 1
NCBI Official Synonym Full Names
melanin-concentrating hormone receptor 1
NCBI Official Symbol
Mchr1
NCBI Official Synonym Symbols
Slc1; Gpr24; Mch-1r
NCBI Protein Information
melanin-concentrating hormone receptor 1; MCHR; MCH1R; SLC-1; MCH-R1; MCHR-1; MCH receptor 1; G protein-coupled receptor 24; G-protein coupled receptor 24; somatostatin receptor-like protein
UniProt Protein Name
Melanin-concentrating hormone receptor 1
UniProt Gene Name
Mchr1
UniProt Synonym Gene Names
Gpr24; Slc1; MCH receptor 1; MCH-R1; MCHR-1; MCH1R; MCHR
UniProt Entry Name
MCHR1_RAT

NCBI Description

receptor for melanin-concentrating hormone (MCH); may mediate intracellular Ca2+ levels, forskolin-stimulated cyclic AMP production, and activation of mitogen-activated protein kinase; may play role in energy homeostasis [RGD, Feb 2006]

Uniprot Description

MCHR1: Receptor for melanin-concentrating hormone, coupled to both G proteins that inhibit adenylyl cyclase and G proteins that activate phosphoinositide hydrolysis. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; Membrane protein, integral; GPCR, family 1; Membrane protein, multi-pass

Cellular Component: nonmotile primary cilium; integral to membrane; plasma membrane

Molecular Function: protein C-terminus binding; hormone binding; melanin-concentrating hormone receptor activity

Biological Process: elevation of cytosolic calcium ion concentration; cell surface receptor linked signal transduction; neuropeptide signaling pathway; positive regulation of calcium ion transport

Research Articles on Mchr1

Similar Products

Product Notes

The Mchr1 mchr1 (Catalog #AAA968069) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-360. The amino acid sequence is listed below: QATCTGCMDL QTSLLSTGPN ASNISDGQDN LTLPGSPPRT GSVSYINIIM PSVFGTICLL GIVGNSTVIF AVVKKSKLHW CSNVPDIFII NLSVVDLLFL LGMPFMIHQL MGNGVWHFGE TMCTLITAMD ANSQFTSTYI LTAMTIDRYL ATVHPISSTK FRKPSMATLV ICLLWALSFI SITPVWLYAR LIPFPGGAVG CGIRLPNPDT DLYWFTLYQF FLAFALPFVV ITAAYVKILQ RMTSSVAPAS QRSIRLRTKR VTRTAIAICL VFFVCWAPYY VLQLTQLSIS RPTLTFVYLY NAAISLGYAN SCLNPFVYIV LCETFRKRLV LSVKPAAQGQ LRTVSNAQTA DEERTESKGT. It is sometimes possible for the material contained within the vial of "Melanin-concentrating hormone receptor 1 (Mchr1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.