Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mitochondrial substrate carrier family protein C (mcfC) Recombinant Protein | mcfC recombinant protein

Recombinant Dictyostelium discoideum Mitochondrial substrate carrier family protein C (mcfC)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitochondrial substrate carrier family protein C (mcfC); Recombinant Dictyostelium discoideum Mitochondrial substrate carrier family protein C (mcfC); Recombinant Mitochondrial substrate carrier family protein C (mcfC); Mitochondrial substrate carrier family protein C; mcfC recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-472
Sequence
MVLNENDKEFVKKLFDSLDKDNNGKLTREEIKEGFFKLRIPSSEKDIESFLTNVDKDKDGSVSFKEFEDFTIENIKKLKIVFEELDTNKSGTLDIHEIEESIKKLNIPLYSEQELIRLFHRIDKNRDNQIDFNEWRELLVLLPNSNLQLIISFWKDSQILDAGFDNGGFIPPMVEKKEKASSLRNTITYMLAGSVAGFASRTSTAPLERVKIMCQLNHGKPISLISAFKACYKDGGIKGFFRGNLANIIKVSPESAVKFGTYEYVKKLFAENDCELTSAQRFISGSVAGVVSHTTLFPLEVVRLRLSAEIAGTYNGIFDCFKKIAISEKSIRPFYRGLGASITATIPHSGVNMMVYEFLKHKVIKMTGNEFPTAGQLLVCASTSSVCGQLVGYPFHVVKSRLITQGSSVNQEKYTGLFDGLTKIIKKEGPIGLYKGIVPSFMKSIPSHSITFIVYEGFKKAFDVNLKEKKHH
Sequence Length
472
Species
Dictyostelium discoideum (Slime mold)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,100 Da
NCBI Official Full Name
EF-hand domain-containing protein
NCBI Official Symbol
mcfC
NCBI Protein Information
EF-hand domain-containing protein; calcium-dependent mitochondrial substrate carrier; mitochondrial substrate carrier family protein
UniProt Protein Name
Mitochondrial substrate carrier family protein C
UniProt Gene Name
mcfC
UniProt Synonym Gene Names
CBP11
UniProt Entry Name
MCFC_DICDI

Uniprot Description

Function: Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane

By similarity.

Subcellular location: Mitochondrion inner membrane; Multi-pass membrane protein

By similarity.

Induction: Down-regulated by phagocytic stimuli.

Sequence similarities: Belongs to the mitochondrial carrier family.Contains 4 EF-hand domains.Contains 3 Solcar repeats.

Similar Products

Product Notes

The mcfC mcfc (Catalog #AAA1015356) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-472. The amino acid sequence is listed below: MVLNENDKEF VKKLFDSLDK DNNGKLTREE IKEGFFKLRI PSSEKDIESF LTNVDKDKDG SVSFKEFEDF TIENIKKLKI VFEELDTNKS GTLDIHEIEE SIKKLNIPLY SEQELIRLFH RIDKNRDNQI DFNEWRELLV LLPNSNLQLI ISFWKDSQIL DAGFDNGGFI PPMVEKKEKA SSLRNTITYM LAGSVAGFAS RTSTAPLERV KIMCQLNHGK PISLISAFKA CYKDGGIKGF FRGNLANIIK VSPESAVKFG TYEYVKKLFA ENDCELTSAQ RFISGSVAGV VSHTTLFPLE VVRLRLSAEI AGTYNGIFDC FKKIAISEKS IRPFYRGLGA SITATIPHSG VNMMVYEFLK HKVIKMTGNE FPTAGQLLVC ASTSSVCGQL VGYPFHVVKS RLITQGSSVN QEKYTGLFDG LTKIIKKEGP IGLYKGIVPS FMKSIPSHSI TFIVYEGFKK AFDVNLKEKK HH. It is sometimes possible for the material contained within the vial of "Mitochondrial substrate carrier family protein C (mcfC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.