Melanocortin receptor 3 (Mc3r) Recombinant Protein | Mc3r recombinant protein

Recombinant Mouse Melanocortin receptor 3 (Mc3r)

• Gene Names: Mc3r; MC3-R
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Melanocortin receptor 3 (Mc3r); Recombinant Mouse Melanocortin receptor 3 (Mc3r); Recombinant Melanocortin receptor 3 (Mc3r); Melanocortin receptor 3; MC3-R; Mc3r recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-323
• Sequence: MNSSCCLSSVSPMLPNLSEHPAAPPASNRSGSGFCEQVFIKPEVFLALGIVSLMENILVILAVVRNGNLHSPMYFFLCSLAAADMLVSLSNSLETIMIAVINSDSLTLEDQFIQHMDNIFDSMICISLVASICNLLAIAIDRYVTIFYALRYHSIMTVRKALTLIGVIWVCCGICGVMFIIYSESKMVIVCLITMFFAMVLLMGTLYIHMFLFARLHVQRIAVLPPAGVVAPQQHSCMKGAVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYAFRSLELRNTFKEILCGCNSMNLG
• Sequence Length: 323

• Species: Mus musculus (Mouse)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 6678822
• NCBI GeneID: 17201
• NCBI Accession #: NP_032587.1
• NCBI GenBank Nucleotide #: NM_008561.3
• UniProt Accession #: P33033
• Molecular Weight: 35,806 Da
• NCBI Official Full Name: melanocortin receptor 3
• NCBI Official Synonym Full Names: melanocortin 3 receptor
• NCBI Official Symbol: Mc3r
• NCBI Official Synonym Symbols: MC3-R
• NCBI Protein Information: melanocortin receptor 3
• UniProt Protein Name: Melanocortin receptor 3
• Protein Family: Melanocortin receptor
• UniProt Gene Name: Mc3r
• UniProt Synonym Gene Names: MC3-R
• UniProt Entry Name: MC3R_MOUSE

NCBI Description

This gene encodes a member of the melanocortin receptor family. Melanocortin receptors are transmembrane G-protein coupled receptors, which respond to small peptide hormones and exhibit diverse functions and tissue type localization. As part of the central nervous melanocortin system, the encoded protein is competitively bound by either melanocyte stimulating hormone or agouti-related protein to regulate energy homeostasis and adaptation to food restriction. Disruption of this gene results in an increased ratio of weight gain to food intake, increased fat mass, and decreased lean mass, without having a large effect on insulin sensitivity or glucose metabolism. [provided by RefSeq, Dec 2012]

Uniprot Description

MC3R: Receptor for MSH (alpha, beta and gamma) and ACTH. This receptor is mediated by G proteins which activate adenylate cyclase. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR

Cellular Component: membrane; plasma membrane; integral to membrane

Molecular Function: G-protein coupled receptor activity; neuropeptide binding; signal transducer activity; protein binding; melanocortin receptor activity; peptide hormone binding; melanocyte stimulating hormone receptor activity

Biological Process: G-protein signaling, coupled to cAMP nucleotide second messenger; locomotor rhythm; G-protein coupled receptor protein signaling pathway; regulation of heart rate; homoiothermy; regulation of blood pressure; positive regulation of cAMP biosynthetic process; rhythmic process; circadian regulation of gene expression; signal transduction