Melanocortin receptor 3 (Mc3r) Recombinant Protein | Mc3r recombinant protein

Recombinant Mouse Melanocortin receptor 3 (Mc3r)

Cat. Num. AAA7019946

• Gene Names: Mc3r; MC3-R
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Melanocortin receptor 3 (Mc3r); Recombinant Mouse Melanocortin receptor 3 (Mc3r); Mc3r recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-323aa; Full length protein
• Sequence: MNSSCCLSSVSPMLPNLSEHPAAPPASNRSGSGFCEQVFIKPEVFLALGIVSLMENILVI LAVVRNGNLHSPMYFFLCSLAAADMLVSLSNSLETIMIAVINSDSLTLEDQFIQHMDNIF DSMICISLVASICNLLAIAIDRYVTIFYALRYHSIMTVRKALTLIGVIWVCCGICGVMFI IYSESKMVIVCLITMFFAMVLLMGTLYIHMFLFARLHVQRIAVLPPAGVVAPQQHSCMKG AVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYA FRSLELRNTFKEILCGCNSMNLG
• Sequence Length: Full length protein

• Application Notes: This is a recombinant transmembrane protein expressed in a cell-free expression system.
• Species: Mouse
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for Mc3r recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 6678822
• NCBI GeneID: 17201
• NCBI Accession #: NP_032587.1
• NCBI GenBank Nucleotide #: NM_008561.3
• UniProt Accession #: P33033
• Molecular Weight: 35,806 Da
• NCBI Official Full Name: melanocortin receptor 3
• NCBI Official Synonym Full Names: melanocortin 3 receptor
• NCBI Official Symbol: Mc3r
• NCBI Official Synonym Symbols: MC3-R
• NCBI Protein Information: melanocortin receptor 3
• UniProt Protein Name: Melanocortin receptor 3
• Protein Family: Melanocortin receptor
• UniProt Gene Name: Mc3r
• UniProt Synonym Gene Names: MC3-R
• UniProt Entry Name: MC3R_MOUSE

NCBI Description

This gene encodes a member of the melanocortin receptor family. Melanocortin receptors are transmembrane G-protein coupled receptors, which respond to small peptide hormones and exhibit diverse functions and tissue type localization. As part of the central nervous melanocortin system, the encoded protein is competitively bound by either melanocyte stimulating hormone or agouti-related protein to regulate energy homeostasis and adaptation to food restriction. Disruption of this gene results in an increased ratio of weight gain to food intake, increased fat mass, and decreased lean mass, without having a large effect on insulin sensitivity or glucose metabolism. [provided by RefSeq, Dec 2012]

Uniprot Description

MC3R: Receptor for MSH (alpha, beta and gamma) and ACTH. This receptor is mediated by G proteins which activate adenylate cyclase. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 1

Cellular Component: integral to membrane; membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; melanocortin receptor activity; melanocyte stimulating hormone receptor activity; neuropeptide binding; peptide hormone binding; protein binding; signal transducer activity

Biological Process: circadian regulation of gene expression; G-protein coupled receptor protein signaling pathway; G-protein signaling, coupled to cAMP nucleotide second messenger; homoiothermy; locomotor rhythm; positive regulation of cAMP biosynthetic process; regulation of blood pressure; regulation of heart rate; rhythmic process; signal transduction