Myelin basic protein S (Mbp) Recombinant Protein | Mbp recombinant protein

Recombinant Rat Myelin basic protein S (Mbp)

Cat. Num. AAA1083309

• Gene Names: Mbp; Mbps
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Myelin basic protein S (Mbp); Recombinant Rat Myelin basic protein S (Mbp); Mbp recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-195, full length protein
• Sequence: ASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFSGDRGAPKRGSGKVPWLKQSRSPLPSHARSRPGLCHMYKDSHTRTTHYGSLPQKSQRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQKPGFGYGGRASDYKSAHKGFKGAYDAQGTLSKIFKLGGRDSRSGSPMARR
• Sequence Length: 194

• Species: Rat
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Mbp recombinant protein

The protein encoded by the classic MBP gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, MBP-related transcripts are also present in the bone marrow and the immune system. These mRNAs arise from the long MBP gene (otherwise called Golli-MBP ) that contains 3 additional exons located upstream of the classic MBP exons. Alternative splicing from the Golli and the MBP transcription start sites gives rise to 2 sets of MBP-related transcripts and gene products. The Golli mRNAs contain 3 exons unique to Golli-MBP, spliced in-frame to 1 or more MBP exons. They encode hybrid proteins that have N-terminal Golli aa sequence linked to MBP aa sequence. The second family of transcripts contain only MBP exons and produce the well characterized myelin basic proteins. This complex gene structure is conserved among species suggesting that the MBP transcription unit is an integral part of the Golli transcription unit and that this arrangement is important for the function and
or regulation of these genes.

NCBI and Uniprot Product Information

• NCBI GI #: 70166245
• NCBI GeneID: 24547
• NCBI Accession #: NP_001020462.1
• NCBI GenBank Nucleotide #: NM_001025291.1
• UniProt Accession #: P02688; Q505J1; Q8R4K6; Q9Z1J4; Q9Z1J5; Q9Z1J6
• Molecular Weight: 17,240 Da
• NCBI Official Full Name: myelin basic protein isoform 1
• NCBI Official Synonym Full Names: myelin basic protein
• NCBI Official Symbol: Mbp
• NCBI Official Synonym Symbols: Mbps
• NCBI Protein Information: myelin basic protein; Golli-Mbp
• UniProt Protein Name: Myelin basic protein
• Protein Family: Myelin basic protein
• UniProt Gene Name: Mbp
• UniProt Synonym Gene Names: MBP

NCBI Description

The protein encoded by the classic Mbp gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, Mbp-related transcripts are also present in the bone marrow and the immune system. These mRNAs arise from the long Mbp gene (otherwise called "Golli-Mbp") that contains 3 additional exons located upstream of the classic Mbp exons. Alternative splicing from the Golli and the Mbp transcription start sites gives rise to 2 sets of Mbp-related transcripts and gene products. The Golli mRNAs contain 3 exons unique to Golli-Mbp, spliced in-frame to 1 or more Mbp exons. They encode hybrid proteins that have N-terminal Golli aa sequence linked to Mbp aa sequence. The second family of transcripts contain only Mbp exons and produce the well characterized myelin basic proteins. This complex gene structure is conserved among species suggesting that the Mbp transcription unit is an integral part of the Golli transcription unit and that this arrangement is important for the function and/or regulation of these genes. Mutation of the Mbp gene is associated with the 'shiverer' and 'myelin deficient' phenotypes in mouse. [provided by RefSeq, Jul 2008]

Uniprot Description

Is, with PLP, the most abundant protein component of the myelin membrane in the CNS. Has a role in both the formation and stabilization of this compact multilayer arrangement of bilayers. Each splice variant and charge isomer may have a specialized function in the assembly of an optimized, biochemically functional myelin membrane ().