Nucleoside triphosphate pyrophosphohydrolase (mazG) Recombinant Protein | mazG recombinant protein
Recombinant Mycobacterium tuberculosis Nucleoside triphosphate pyrophosphohydrolase (mazG)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nucleoside triphosphate pyrophosphohydrolase (mazG); Recombinant Mycobacterium tuberculosis Nucleoside triphosphate pyrophosphohydrolase (mazG); mazG recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-325, Full length protein
Sequence
MIVVLVDPRRPTLVPVEAIEFLRGEVQYTEEMPVAVPWSLPAARSAHAGNDAPVLLSSDPNHPAVITRLAAGARLISAPDSQRGERLVDAVAMMDKLRTAGPWESEQTHDSLRRYLLEETYELLDAVRSGSVDQLREELGDLLLQVLFHARIAEDASQSPFTIDDVADTLMRKLGNRAPGVLAGESISLEDQLAQWEAAKASEKARKSVADDVHTGQPALALAQKVIQRAQKAGLPAHLIPDEITSVSVSADVDAENTLRTAVLDFIDRLRCAERAIAVARRGSNVAEQLDVTPLGVITEQEWLAHWPTAVNDSRGGSKKRKGMR
Sequence Length
325
Species
Mycobacterium tuberculosis
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35,413 Da
NCBI Official Full Name
nucleoside triphosphate pyrophosphohydrolase
NCBI Official Symbol
Rv1021
NCBI Protein Information
nucleoside triphosphate pyrophosphohydrolase
UniProt Protein Name
Nucleoside triphosphate pyrophosphohydrolase
Protein Family
UniProt Gene Name
mazG
UniProt Synonym Gene Names
NTP-PPase
Uniprot Description
Required to maintain the full capacity of the mycobacterium to respond to oxidative stress via the degradation of oxidation-induced damaged nucleotides. Hydrolyzes all canonical (d)NTPs, as well as mutagenic dUTP and 8-oxo-7,8-dihydro-2'-deoxyguanosine 5'-triphosphate (8-oxo-dGTP). Also involved in the transcriptional activation of RelA in response to oxidative stress.
Research Articles on mazG
Similar Products
Product Notes
The mazG mazg (Catalog #AAA1154492) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-325, Full length protein. The amino acid sequence is listed below: MIVVLVDPRR PTLVPVEAIE FLRGEVQYTE EMPVAVPWSL PAARSAHAGN DAPVLLSSDP NHPAVITRLA AGARLISAPD SQRGERLVDA VAMMDKLRTA GPWESEQTHD SLRRYLLEET YELLDAVRSG SVDQLREELG DLLLQVLFHA RIAEDASQSP FTIDDVADTL MRKLGNRAPG VLAGESISLE DQLAQWEAAK ASEKARKSVA DDVHTGQPAL ALAQKVIQRA QKAGLPAHLI PDEITSVSVS ADVDAENTLR TAVLDFIDRL RCAERAIAVA RRGSNVAEQL DVTPLGVITE QEWLAHWPTA VNDSRGGSKK RKGMR. It is sometimes possible for the material contained within the vial of "Nucleoside triphosphate pyrophosphohydrolase (mazG), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
