mRNA interferase MazF (mazF) Recombinant Protein | mazF recombinant protein

Recombinant Escherichia coli O157:H7 mRNA interferase MazF (mazF)

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

mRNA interferase MazF (mazF); Recombinant Escherichia coli O157:H7 mRNA interferase MazF (mazF); mazF recombinant protein

Ordering
Cat. Num. AAA1093847 When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures. For Research Use Only!

Host

E Coli or Yeast or Baculovirus or Mammalian Cell

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Lyophilized or liquid (Format to be determined during the manufacturing process)

Sequence Positions

1-111, Full length protein

Sequence

MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG

Sequence Length

111

Species

Escherichia coli O157:H7

Preparation and Storage

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #

15832896

NCBI GeneID

916551

NCBI Accession #

NP_311669.1

NCBI GenBank Nucleotide #

NC_002695.1

UniProt Accession #

P0AE71; P33645

Molecular Weight

12,098 Da

NCBI Official Full Name

toxin ChpA

NCBI Official Symbol

ECs3642

NCBI Protein Information

toxin ChpA

UniProt Protein Name

Endoribonuclease MazF

Protein Family

Endoribonuclease

UniProt Gene Name

mazF

UniProt Synonym Gene Names

chpA

Uniprot Description

Toxic component of a type II toxin-antitoxin (TA) system. MazF is a sequence-specific endoribonuclease that inhibits protein synthesis and induces bacterial stasis. It is very stable, single-strand specific and cleavage is independent of the ribosome. The endoribonuclease activity (a toxin) is inhibited by the labile cognate antitoxin MazE. Toxicity results when the levels of MazE decrease in the cell, leading to mRNA degradation. Both MazE and MazE-MazF bind to the promoter region of the mazE-mazF operon to inhibit their transcription.

Similar Products

Product Notes

The mazF mazf (Catalog #AAA1093847) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-111, Full length protein. The amino acid sequence is listed below: MVSRYVPDMG DLIWVDFDPT KGSEQAGHRP AVVLSPFMYN NKTGMCLCVP CTTQSKGYPF EVVLSGQERD GVALADQVKS IAWRARGATK KGTVAPEELQ LIKAKINVLI G. It is sometimes possible for the material contained within the vial of "mRNA interferase MazF (mazF), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...