mRNA interferase MazF (mazF) Recombinant Protein | mazF recombinant protein

Recombinant Escherichia coli mRNA interferase MazF (mazF)

Cat. Num. AAA1006277

• Gene Names: mazF; chpA; chpAK; ECK2776; JW2753
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: mRNA interferase MazF (mazF); Recombinant Escherichia coli mRNA interferase MazF (mazF); mazF recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-111, full length protein
• Sequence: MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG
• Sequence Length: 111

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 16130689
• NCBI GeneID: 947252
• NCBI Accession #: NP_417262.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P0AE70; P33645; Q2MA50
• Molecular Weight: 12,098 Da
• NCBI Official Full Name: mRNA interferase toxin, antitoxin is MazE
• NCBI Official Symbol: mazF
• NCBI Official Synonym Symbols: chpA; chpAK; ECK2776; JW2753
• NCBI Protein Information: mRNA interferase toxin, antitoxin is MazE
• UniProt Protein Name: Endoribonuclease toxin MazF
• Protein Family: Endoribonuclease
• UniProt Gene Name: mazF
• UniProt Synonym Gene Names: chpA; chpAK

NCBI Description

MazF is a sequence-specific (ACA) endoribonuclease, induced by amino acid starvation, but in a lon-dependent, ppGpp-independent fashion. [More information is available at EcoGene: EG11249]. MazF is a toxin that is counteracted by the MazE antitoxin . [More information is available at EcoCyc: EG11249].

Uniprot Description

Toxic component of a type II toxin-antitoxin (TA) system. A sequence-specific endoribonuclease it inhibits protein synthesis by cleaving mRNA and inducing bacterial stasis. It is stable, single-strand specific with mRNA cleavage independent of the ribosome, although translation enhances cleavage for some mRNAs (PubMed:18854355). Cleavage occurs at the 5'-end of ACA sequences, yielding a 2',3'-cyclic phosphate and a free 5'-OH, although cleavage can also occur on the 3'-end of the first A (PubMed:15537630, PubMed:23280569). Digests 16S rRNA in vivo 43 nts upstream of the C-terminus; this removes the anti-Shine-Dalgarno sequence forming a mixed population of wild-type and "stress ribosomes". Stress ribosomes do not translate leader-containing mRNA but are proficient in translation of leaderless mRNA, which alters the protein expression profile of the cell; MazF produces some leaderless mRNA (PubMed:21944167). The toxic endoribonuclease activity is inhibited by its labile cognate antitoxin MazE. Toxicity results when the levels of MazE decrease in the cell, leading to mRNA degradation. This effect can be rescued by expression of MazE, but after 6 hours in rich medium overexpression of MazF leads to programmed cell death (PubMed:8650219, PubMed:11222603). MazF-mediated cell death occurs following a number of stress conditions in a relA-dependent fashion and only when cells are in log phase; sigma factor S (rpoS) protects stationary phase cells from MazF-killing (PubMed:15150257, PubMed:19251848). Cell growth and viability are not affected when MazF and MazE are coexpressed. Both MazE and MazE-MazF bind to the promoter region of the mazE-mazF operon to inhibit their own transcription. MazE has higher affinity for promoter DNA in the presence of MazF (PubMed:25564525). Cross-talk can occur between different TA systems, ectopic expression of this toxin induces transcription of the relBEF TA system operon with specific cleavage of the mRNA produced (PubMed:23432955).