E3 ubiquitin-protein ligase MARCH8 (MARCH8) Recombinant Protein | MARCH8 recombinant protein

Recombinant Human E3 ubiquitin-protein ligase MARCH8 (MARCH8)

Cat. Num. AAA7006885

• Gene Names: MARCH8; MIR; CMIR; c-MIR; RNF178; MARCH-VIII
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: E3 ubiquitin-protein ligase MARCH8 (MARCH8); Recombinant Human E3 ubiquitin-protein ligase MARCH8 (MARCH8); MARCH8 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-291aa; full length protein
• Sequence: MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNISKAGSPPSASA PAPVSSFSRTSITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDT RCCELCKYEFIMETKLKPLRKWEKLQMTSSERRKIMCSVTFHVIAITCVVWSLYVLIDRT AEEIKQGQATGILEWPFWTKLVVVAIGFTGGLLFMYVQCKVYVQLWKRLKAYNRVIYVQN CPETSKKNIFEKSPLTEPNFENKHGYGICHSDTNSSCCTEPEDTGAEIIHV
• Sequence Length: Full length protein

• Application Notes: This is a recombinant transmembrane protein expressed in a cell-free expression system.
• Species: Human
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for MARCH8 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 50539414
• NCBI GeneID: 220972
• NCBI Accession #: NP_001002266.1
• NCBI GenBank Nucleotide #: NM_001002266.2
• UniProt Accession #: Q5T0T0; Q5T0S8; Q8TC72; B2R8E7; H0Y7C6
• Molecular Weight: 63,319 Da
• NCBI Official Full Name: E3 ubiquitin-protein ligase MARCH8 isoform a
• NCBI Official Synonym Full Names: membrane associated ring-CH-type finger 8
• NCBI Official Symbol: MARCH8
• NCBI Official Synonym Symbols: MIR; CMIR; c-MIR; RNF178; MARCH-VIII
• NCBI Protein Information: E3 ubiquitin-protein ligase MARCH8
• UniProt Protein Name: E3 ubiquitin-protein ligase MARCH8
• UniProt Gene Name: MARCH8
• UniProt Synonym Gene Names: MIR; RNF178; c-MIR; MARCH-VIII
• UniProt Entry Name: MARH8_HUMAN

NCBI Description

MARCH8 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH8 induces the internalization of several membrane glycoproteins (Goto et al., 2003 [PubMed 12582153]; Bartee et al., 2004 [PubMed 14722266]).[supplied by OMIM, Apr 2010]

Uniprot Description

MARCH8: E3 ubiquitin-protein ligase that mediates ubiquitination of CD86 and MHC class II proteins, such as HLA-DR alpha and beta, and promotes their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. May also promote ubiquitination and endocytosis of TFRC and FAS.

Protein type: EC 6.3.2.-; Ligase; Ubiquitin conjugating system; Ubiquitin ligase; Membrane protein, integral; Membrane protein, multi-pass; EC 6.3.2.19

Chromosomal Location of Human Ortholog: 10q11.21

Cellular Component: cytoplasmic vesicle membrane; early endosome membrane; endosome; integral to membrane; lysosomal membrane; lysosome

Molecular Function: ligase activity; MHC class II protein binding; ubiquitin-protein ligase activity; zinc ion binding

Biological Process: adaptive immune response; antigen processing and presentation of peptide antigen via MHC class II; negative regulation of MHC class II biosynthetic process; protein polyubiquitination