Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

MAP3K7 C-terminal-like protein Recombinant Protein | MAP3K7CL recombinant protein

Recombinant Human MAP3K7 C-terminal-like protein

Gene Names
MAP3K7CL; TAKL; TAK1L; TAKL-1; TAKL-2; TAKL-4; C21orf7; HC21ORF7
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
MAP3K7 C-terminal-like protein; Recombinant Human MAP3K7 C-terminal-like protein; TAK1-like protein; MAP3K7CL recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-142aa; Full Length of Isoform D
Sequence
MISTARVPADKPVRIAFSLNDASDDTPPEDSIPLVFPELDQQLQPLPPCHDSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEALTEENRTLRLAQSQCVEQLEKLRIQYQKRQGSS
Sequence Length
142
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Product Categories/Family for MAP3K7CL recombinant protein
References
Cloning and characterization of a new gene, C21orf7, similar to the TAB2-binding region of TAK1.Solans A., Domenech A., Estivill X., de la Luna S.From PREDs and open reading frames to cDNA isolation revisiting the human chromosome 21 transcription map.Reymond A., Friedli M., Neergaard Henrichsen C., Chapot F., Deutsch S., Ucla C., Rossier C., Lyle R., Guipponi M., Antonarakis S.E.Genomics 78:46-54(2001) Cloning and characterization of a novel human TGF-beta activated kinase-like gene.Li J., Ji C., Yang Q., Chen J., Gu S., Ying K., Xie Y., Mao Y.Biochem. Genet. 42:129-137(2004) The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007) The DNA sequence of human chromosome 21.Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A., Menzel U., Delabar J., Kumpf K., Lehmann R., Patterson D., Reichwald K., Rump A., Schillhabel M., Schudy A., Zimmermann W., Rosenthal A., Kudoh J., Shibuya K., Kawasaki K., Asakawa S., Shintani A., Sasaki T., Nagamine K., Mitsuyama S., Antonarakis S.E., Minoshima S., Shimizu N., Nordsiek G., Hornischer K., Brandt P., Scharfe M., Schoen O., Desario A., Reichelt J., Kauer G., Bloecker H., Ramser J., Beck A., Klages S., Hennig S., Riesselmann L., Dagand E., Wehrmeyer S., Borzym K., Gardiner K., Nizetic D., Francis F., Lehrach H., Reinhardt R., Yaspo M.-L.Nature 405:311-319(2000)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32.4 kDa
NCBI Official Full Name
MAP3K7 C-terminal-like protein isoform 2
NCBI Official Synonym Full Names
MAP3K7 C-terminal like
NCBI Official Symbol
MAP3K7CL
NCBI Official Synonym Symbols
TAKL; TAK1L; TAKL-1; TAKL-2; TAKL-4; C21orf7; HC21ORF7
NCBI Protein Information
MAP3K7 C-terminal-like protein
UniProt Protein Name
MAP3K7 C-terminal-like protein
UniProt Gene Name
MAP3K7CL
UniProt Synonym Gene Names
C21orf7; TAK1L
UniProt Entry Name
M3KCL_HUMAN

Uniprot Description

MAP3K7CL: 4 isoforms of the human protein are produced by alternative splicing

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: cytosol; nucleus

Molecular Function: MAP kinase kinase kinase activity; protein binding

Biological Process: activation of MAPKK activity; MAPKKK cascade

Similar Products

Product Notes

The MAP3K7CL map3k7cl (Catalog #AAA1148513) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-142aa; Full Length of Isoform D. The amino acid sequence is listed below: MISTARVPAD KPVRIAFSLN DASDDTPPED SIPLVFPELD QQLQPLPPCH DSEESMEVFK QHCQIAEEYH EVKKEITLLE QRKKELIAKL DQAEKEKVDA AELVREFEAL TEENRTLRLA QSQCVEQLEK LRIQYQKRQG SS. It is sometimes possible for the material contained within the vial of "MAP3K7 C-terminal-like protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.