Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Transforming Growth Factor beta-3 (TGFB3) Active Protein | TGFB3 active protein

Recombinant Human Transforming Growth Factor beta-3 (TGFB3), Partial

Gene Names
TGFB3; ARVD; LDS5; RNHF; ARVD1; TGF-beta3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transforming Growth Factor beta-3 (TGFB3); Recombinant Human Transforming Growth Factor beta-3 (TGFB3); Partial; Transforming growth factor beta-3; TGFB3; TGF-beta-3; Latency-associated peptide; LAP; TGFB3 active protein
Ordering
For Research Use Only!
Host
Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 4 mM HCl
Sequence Positions
301-412aa(Y340F); Partial
Sequence
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
Sequence Length
412
Species
Human
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T cells is less than 2 ng/ml.
Subcellular Location
Secreted
Protein Families
TGF-beta Family
Classification
Cytokine
Subdivision
Growth Factor
Pathway
Hippo Signaling Pathway
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for TGFB3 active protein
Relevance: Transforming growth factor beta 3(TGFB3) is a member of a TGF -beta superfamily which is defined by theirstructural and functional similarities. TGFB3 is secreted as a complex with LAP. This latent form of TGFB3becomes active upon cleavage by plasmin, matrix metalloproteases, thrombospondin -1, and a subset ofintegrins. It binds with high affinity to TGF- beta RII, a type II serine/threonine kinase receptor. TGFB3 is involved incell differentiation, embryogenesis and development. It is believed to regulate molecules involved in cellularadhesion and extracellular matrix (ECM) formation during the process of palate development. Without TGF-beta3, mammals develop a deformity known as a cleft palate.

Function: Involved in embryogenesis and cell differentiation.
Product Categories/Family for TGFB3 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12.7 kDa
NCBI Official Full Name
transforming growth factor beta-3 proprotein isoform 1 preproprotein
NCBI Official Synonym Full Names
transforming growth factor beta 3
NCBI Official Symbol
TGFB3
NCBI Official Synonym Symbols
ARVD; LDS5; RNHF; ARVD1; TGF-beta3
NCBI Protein Information
transforming growth factor beta-3 proprotein
UniProt Protein Name
Transforming growth factor beta-3
UniProt Gene Name
TGFB3
UniProt Synonym Gene Names
TGF-beta-3; LAP
UniProt Entry Name
TGFB3_HUMAN

NCBI Description

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGF-beta family members. This protein is involved in embryogenesis and cell differentiation, and may play a role in wound healing. Mutations in this gene are a cause of aortic aneurysms and dissections, as well as familial arrhythmogenic right ventricular dysplasia 1. [provided by RefSeq, Aug 2016]

Uniprot Description

TGFB3: Involved in embryogenesis and cell differentiation. Homodimer; disulfide-linked. Interacts with ASPN. Belongs to the TGF-beta family.

Protein type: Cell development/differentiation; Motility/polarity/chemotaxis; Ligand, receptor tyrosine kinase; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 14q24

Cellular Component: extracellular matrix; extracellular space; cell surface; cell soma; T-tubule; extracellular region; plasma membrane; nucleus

Molecular Function: identical protein binding; protein binding; growth factor activity; transforming growth factor beta binding; protein heterodimerization activity; punt binding; cytokine activity

Biological Process: extracellular matrix organization and biogenesis; positive regulation of apoptosis; activation of MAPK activity; positive regulation of transcription, DNA-dependent; positive regulation of collagen biosynthetic process; female pregnancy; SMAD protein nuclear translocation; palate development; odontogenesis; regulation of apoptosis; negative regulation of cell proliferation; platelet degranulation; mammary gland development; transforming growth factor beta receptor signaling pathway; salivary gland morphogenesis; embryonic neurocranium morphogenesis; negative regulation of neuron apoptosis; cell growth; inner ear development; aging; positive regulation of filopodium formation; uterine wall breakdown; intercellular junction assembly and maintenance; platelet activation; in utero embryonic development; positive regulation of bone mineralization; regulation of cell proliferation; positive regulation of protein secretion; gut development; negative regulation of DNA replication; response to estrogen stimulus; regulation of MAPKKK cascade; positive regulation of cell division; response to hypoxia; positive regulation of transcription from RNA polymerase II promoter; response to progesterone stimulus; blood coagulation; negative regulation of transforming growth factor beta receptor signaling pathway; alveolus development; positive regulation of DNA replication

Disease: Arrhythmogenic Right Ventricular Dysplasia, Familial, 1; Rienhoff Syndrome

Research Articles on TGFB3

Similar Products

Product Notes

The TGFB3 tgfb3 (Catalog #AAA7115002) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 301-412aa(Y340F); Partial. The amino acid sequence is listed below: ALDTNYCFRN LEENCCVRPL YIDFRQDLGW KWVHEPKGYF ANFCSGPCPY LRSADTTHST VLGLYNTLNP EASASPCCVP QDLEPLTILY YVGRTPKVEQ LSNMVVKSCK CS. It is sometimes possible for the material contained within the vial of "Transforming Growth Factor beta-3 (TGFB3), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.