Syndecan-2 (SDC2) Active Protein | SDC2 active protein

Recombinant Human Syndecan-2 (SDC2), Partial

Cat. Num. AAA7115145

• Gene Names: SDC2; HSPG; CD362; HSPG1; SYND2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Syndecan-2 (SDC2); Recombinant Human Syndecan-2 (SDC2); Partial; Syndecan-2; SYND2; Fibroglycan; Heparan Sulfate Proteoglycan Core Protein; HSPG; CD362; SDC2; HSPG1; SDC2 active protein

• Host: Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM Tris-Citrate, 150 mM NaCl, pH 7.0
• Sequence Positions: 19-144aa; Partial
• Sequence: ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTE
• Sequence Length: 201

• Species: Human
• Tag: C-terminal 6xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to bind Human FGFb in functional ELISA is less than 5 ug/ml.
• Subcellular Location: Membrane, Single-Pass Type I Membrane Protein
• Protein Families: Syndecan Proteoglycan Family
• Classification: Other Recombinant Protein
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for SDC2 active protein

Relevance: Syndecan-2 is a member of the Syndecans family comprised of type I transmembrane heparan sulfate proteoglycans (HSPG) that are involved in the regulation of many cellular processes. Four sub-types of mammalian Syndecans have been reported and among them. Syndecan-2 plays a role in the cancer development. It can affect the basal and chemotherapy-induced apoptosis in osteosarcoma. It can also suppress MMP2 activation, suppressing metastasis.

Function: Cell surface proteoglycan that bears heparan sulfate. Regulates dendritic arbor morphogenesis (By similarity).

Product Categories/Family for SDC2 active protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 158962336
• NCBI GeneID: 6383
• UniProt Accession #: P34741
• Molecular Weight: 14.98 kDa
• NCBI Official Full Name: Syndecan-2
• NCBI Official Synonym Full Names: syndecan 2
• NCBI Official Symbol: SDC2
• NCBI Official Synonym Symbols: HSPG; CD362; HSPG1; SYND2
• NCBI Protein Information: syndecan-2
• UniProt Protein Name: Syndecan-2
• Protein Family: Syndecan
• UniProt Gene Name: SDC2
• UniProt Synonym Gene Names: HSPG1; SYND2; HSPG
• UniProt Entry Name: SDC2_HUMAN

NCBI Description

The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are required for internalization of the HIV-1 tat protein. The syndecan-2 protein functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Altered syndecan-2 expression has been detected in several different tumor types. [provided by RefSeq, Jul 2008]

Uniprot Description

syndecan-2: a heparan sulfate proteoglycan type I membrane protein that belongs to the syndecan proteoglycan family. Preferentially expressed in cells of mesenchymal origin. Is tyrosine phosphorylated and forms a complex with EphB2 in mouse brain. Plays a role in mediating adhesion and proliferation of colon carcinoma cells.

Protein type: Cell adhesion; Cell surface; Membrane protein, integral; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 8q22-q23

Cellular Component: lysosomal lumen; cell soma; Golgi lumen; integral to membrane; plasma membrane; synapse

Molecular Function: protein binding; PDZ domain binding

Biological Process: axon guidance; phototransduction, visible light; extracellular matrix organization and biogenesis; wound healing; glycosaminoglycan metabolic process; dendrite morphogenesis; regulation of dendrite morphogenesis; pathogenesis; response to caffeine; chondroitin sulfate metabolic process; glycosaminoglycan biosynthetic process; glycosaminoglycan catabolic process; carbohydrate metabolic process; ephrin receptor signaling pathway; response to hypoxia; retinoid metabolic process