R-Spondin-1 (RSPO1) Active Protein | RSPO1 active protein

Recombinant Human R-Spondin-1 (RSPO1), Partial

Cat. Num. AAA7115169

• Gene Names: RSPO1; RSPO; CRISTIN3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: R-Spondin-1 (RSPO1); Recombinant Human R-Spondin-1 (RSPO1); Partial; RSPO1; R-spondin1; RP11-566C13.1; CRISTIN3; FLJ40906; RSPO Rspo1; R-spondin; Rspondin; RP23-325M14.2; Roof plate-specific spondin-1; RSPO1 active protein

• Host: Mammalian Cell
• Specificity: Abundantly expressed in adrenal glands, ovary, testis, thyroid and trachea but not in bone marrow, spinal cord, stomach, leukocytes colon, small intestine, prostate, thymus and spleen.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 1xPBS, pH 7.4
• Sequence Positions: 31-263aa; Partial
• Sequence: RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
• Sequence Length: 263

• Species: Human
• Tag: C-terminal 6xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to bind Mouse CD36 in functional ELISA is less than 100 ng/ml.
• Subcellular Location: Secreted, Nucleus
• Protein Families: R-spondin Family
• Classification: Other Recombinant Protein
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for RSPO1 active protein

Relevance: RSPO1 is a secreted protein, containing 2 FU(furin-like) repeats and 1 TSP type-1 domain and belonging to the R-spondin family. RSPO1 is required for the early development of gonads, regardless of sex. It has been found in mice only eleven days after fertilization. To induce cell proliferation, it acts synergistically with WNT4. They help stabilize beta catenin, which activates downstream targets. RSPO1 is necessary in female sex development. It augments the WNT/beta catenin pathway to oppose male sex development. In critical gonadal stages, between six and nine weeks after fertilization, the ovaries upregulate it while the testes downregulate it. RSPO1 can potentially aid in the treatment of mucositis, which is characterized by inflammation of the oral cavity. This unfortunate condition often accompanies chemotherapy and radiation in cancer patients with head and neck tumors.

Function: Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. Upon binding to LGR4-6 (LGR4, LGR5 or LGR6), LGR4-6 associate with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. Also regulates the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by acting as an inhibitor of ZNRF3, an important regulator of the Wnt signaling pathway. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway. Has a essential roles in ovary determination. Regulates Wnt signaling by antagonizing DKK1/KREM1-mediated internalization of LRP6 through an interaction with KREM1.

Product Categories/Family for RSPO1 active protein

Developmental Biology

NCBI and Uniprot Product Information

• NCBI GI #: 84490388
• NCBI GeneID: 284654
• NCBI Accession #: NP_001033722.1
• NCBI GenBank Nucleotide #: NM_001038633.3
• UniProt Accession #: Q2MKA7
• Molecular Weight: 26.6 kDa
• NCBI Official Full Name: R-spondin-1 isoform 1
• NCBI Official Synonym Full Names: R-spondin 1
• NCBI Official Symbol: RSPO1
• NCBI Official Synonym Symbols: RSPO; CRISTIN3
• NCBI Protein Information: R-spondin-1
• UniProt Protein Name: R-spondin-1
• Protein Family: R-spondin
• UniProt Gene Name: RSPO1
• UniProt Synonym Gene Names: hRspo1
• UniProt Entry Name: RSPO1_HUMAN

NCBI Description

This gene encodes a secreted activator protein with two cysteine-rich, furin-like domains and one thrombospondin type 1 domain. The encoded protein is a ligand for leucine-rich repeat-containing G-protein coupled receptors (LGR proteins) and positively regulates the Wnt signaling pathway. In mice, the protein induces the rapid onset of crypt cell proliferation and increases intestinal epithelial healing, providing a protective effect against chemotherapy-induced adverse effects. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]

Uniprot Description

R-spondin-1: Activator of the beta-catenin signaling cascade, leading to TCF-dependent gene activation. Acts both in the canonical Wnt/beta-catenin-dependent pathway and in non-canonical Wnt signaling pathway, probably by acting as an inhibitor of ZNRF3, an important regulator of the Wnt signaling pathway. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway. Has a essential roles in ovary determination. Defects in RSPO1 are the cause of palmoplantar keratoderma with squamous cell carcinoma of skin and sex reversal (PKKSCC). This recessive syndrome is characterized by XX (female to male) SRY-independent sex reversal, palmoplantar hyperkeratosis and predisposition to squamous cell carcinoma of the skin. Belongs to the R-spondin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion; Cell development/differentiation; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 1p34.3

Cellular Component: extracellular space; extracellular region; nucleus

Molecular Function: heparin binding; protein binding; G-protein-coupled receptor binding; receptor binding

Biological Process: regulation of gene expression; regulation of receptor internalization; Wnt receptor signaling pathway through beta-catenin; positive regulation of protein amino acid phosphorylation; male meiosis; positive regulation of Wnt receptor signaling pathway

Disease: Palmoplantar Hyperkeratosis With Squamous Cell Carcinoma Of Skin And 46,xx Sex Reversal