Low Affinity Immunoglobulin gamma Fc Region Receptor III-A (FCGR3A) Active Protein | FCGR3A active protein

Recombinant Human Low Affinity Immunoglobulin gamma Fc Region Receptor III-A (FCGR3A), Partial

Cat. Num. AAA7115108

• Gene Names: FCGR3A; CD16; FCG3; CD16A; FCGR3; IGFR3; IMD20; FCR-10; FCRIII; FCGRIII; FCRIIIA
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Low Affinity Immunoglobulin gamma Fc Region Receptor III-A (FCGR3A); Recombinant Human Low Affinity Immunoglobulin gamma Fc Region Receptor III-A (FCGR3A); Partial; Low Affinity Immunoglobulin Gamma Fc Region Receptor III-A; CD16a Antigen; Fc-Gamma RIII-Alpha; Fc-Gamma RIII; Fc-gamma RIIIa; FcRIII; FcRIIIa; FcR-10; IgG Fc Receptor III-2; CD16a; FCGR3A; CD16A; FCG3; FCGR3; IGFR3; FCGR3A active protein

• Host: Mammalian Cell
• Specificity: Expressed on natural killer cells, macrophages, subpopulation of T-cells, immature thymocytes and placental trophoblasts.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.2
• Sequence Positions: 17-208aa; Extracellular Domain
• Sequence: GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ
• Sequence Length: 254

• Species: Human
• Tag: C-terminal 6xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to bind Human IGHG1 in functional ELISA is less than 20 ug/ml.
• Subcellular Location: Cell Membrane, Single-Pass Type I Membrane Protein, Secreted
• Classification: Drug Target
• Subdivision: FC Receptor
• Pathway: Fc gamma R-Mediated Phagocytosis
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for FCGR3A active protein

Relevance: Receptors for the Fc region of immunoglobin G (FcgammaR) are divided into three classes and FcgammaRIII is a multifunctional, low/intermediate affinity receptor. In humans, FcgammaRIII is expressed as two distinct forms (FcgammaRIIIA and FcgammaRIIIB) that are encoded by two different but highly homologous genes in a cell type-specific manner. FcgammaRIIIB is a low-affinity, GPI-linked receptor expressed by neutrophils and eosinophils, whereas FcgammaRIIIA is an intermediate affinity polypeptide-anchored transmembrane glycoprotein expressed by a subset of T lymphocytes, natural killer (NK) cells, monocytes, and macrophages. The FcgammaRIIIA receptor is involved in phagocytosis, secretion of enzymes, inflammatory mediators, antibody-dependent cellular cytotoxicity (ADCC), mast cell degranulation, and clearance of immune complexes. FcgammaRIIIA has an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain and delivers an activation signal in the immune responses. Aberrant expression or mutations in this gene is implicated in susceptibility to recurrent viral infections, systemic lupus erythematosus, and alloimmune neonatal neutropenia. In humans, it is a 50 -70 kD type I transmembrane activating receptor. The FcgammaRIIIA cDNA encodes 254 amino acid including a 16aa signal sequence, 191 amino acid ECD with two C2-type Ig-like domains, five potential N-glycosylation sites, a 22 amino acid transmembrane sequence and a 25 amino acid cytoplasmic domain.

Function: Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.

Product Categories/Family for FCGR3A active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 119876
• NCBI GeneID: 2214
• UniProt Accession #: P08637
• Molecular Weight: 22.61 kDa
• NCBI Official Full Name: Low affinity immunoglobulin gamma Fc region receptor III-A
• NCBI Official Synonym Full Names: Fc fragment of IgG receptor IIIa
• NCBI Official Symbol: FCGR3A
• NCBI Official Synonym Symbols: CD16; FCG3; CD16A; FCGR3; IGFR3; IMD20; FCR-10; FCRIII; FCGRIII; FCRIIIA
• NCBI Protein Information: low affinity immunoglobulin gamma Fc region receptor III-A
• UniProt Protein Name: Low affinity immunoglobulin gamma Fc region receptor III-A
• Protein Family: Low affinity immunoglobulin gamma Fc region receptor
• UniProt Gene Name: FCGR3A
• UniProt Synonym Gene Names: CD16A; FCG3; FCGR3; IGFR3; Fc-gamma RIII; Fc-gamma RIIIa; FcRIII; FcRIIIa
• UniProt Entry Name: FCG3A_HUMAN

NCBI Description

This gene encodes a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other other antibody-dependent responses. This gene (FCGR3A) is highly similar to another nearby gene (FCGR3B) located on chromosome 1. The receptor encoded by this gene is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

FCGR3A: Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q23

Cellular Component: integral to membrane; plasma membrane; external side of plasma membrane

Molecular Function: IgG binding

Biological Process: regulation of immune response; innate immune response; immune response

Disease: Immunodeficiency 20