Erythropoietin (EPO) Active Protein | EPO active protein

Recombinant Human Erythropoietin (EPO)

Cat. Num. AAA7114954

• Gene Names: EPO; EP; DBAL; ECYT5; MVCD2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Erythropoietin (EPO); Recombinant Human Erythropoietin (EPO); Erythropoietin; Epoetin; EPO; EPO active protein

• Host: Mammalian Cell
• Specificity: Produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 1xPBS, pH 7.4
• Sequence Positions: 28-193aa
• Sequence: APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

• Species: Human
• Tag: C-terminal 6xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined in a cell proliferation assay using TF-1 human erythroleukemic cells is less than 5 ng/ml
• Subcellular Location: Secreted
• Protein Families: EPO/TPO Family
• Classification: Cytokine
• Subdivision: Colony Stimulating Factor
• Pathway: HIF-1 Signaling Pathway
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for EPO active protein

Relevance: Erythropoietin (EPO) is a glycoprotein hormone that is principally known for its role in erythropoiesis, where it is responsible for stimulating proliferation and differentiation of erythroid progenitor cells. Erythropoietin is a member of the EPO/TPO family. It is a secreted, glycosylated cytokine composed of four alpha helical bundles. The differentiation of CFU-E (Colony Forming Unit-Erythroid) cells into erythrocytes can only be accomplished in the presence of EPO. Physiological levels of EPO in adult mammals are maintained primarily by the kidneys, whereas levels in fetal or neonatal mammals are maintained by the liver. EPO also can exert various non-hematopoietic activities, including vascularization and proliferation of smooth muscle, neural protection during hypoxia, and stimulation of certain B cells. Genetic variation in erythropoietin is associated with susceptbility to microvascular complications of diabetes type 2. These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy.

Function: Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3.

Product Categories/Family for EPO active protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 62240997
• NCBI GeneID: 2056
• NCBI Accession #: NP_000790.2
• NCBI GenBank Nucleotide #: NM_000799.4
• UniProt Accession #: P01588
• Molecular Weight: 19.2 kDa
• NCBI Official Full Name: erythropoietin
• NCBI Official Synonym Full Names: erythropoietin
• NCBI Official Symbol: EPO
• NCBI Official Synonym Symbols: EP; DBAL; ECYT5; MVCD2
• NCBI Protein Information: erythropoietin
• UniProt Protein Name: Erythropoietin
• Protein Family: Erythropoietin
• UniProt Gene Name: EPO
• UniProt Entry Name: EPO_HUMAN

NCBI Description

This gene encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The encoded protein is mainly synthesized in the kidney, secreted into the blood plasma, and binds to the erythropoietin receptor to promote red blood cell production, or erythropoiesis, in the bone marrow. Expression of this gene is upregulated under hypoxic conditions, in turn leading to increased erythropoiesis and enhanced oxygen-carrying capacity of the blood. Expression of this gene has also been observed in brain and in the eye, and elevated expression levels have been observed in diabetic retinopathy and ocular hypertension. Recombinant forms of the encoded protein exhibit neuroprotective activity against a variety of potential brain injuries, as well as antiapoptotic functions in several tissue types, and have been used in the treatment of anemia and to enhance the efficacy of cancer therapies. [provided by RefSeq, Aug 2017]

Uniprot Description

EPO: Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Genetic variation in EPO is associated with susceptbility to microvascular complications of diabetes type 2 (MVCD2). These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. Belongs to the EPO/TPO family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 7q22

Cellular Component: cell surface; extracellular region; extracellular space

Molecular Function: protein binding

Biological Process: erythrocyte differentiation; negative regulation of transcription from RNA polymerase II promoter; positive regulation of cell proliferation; positive regulation of DNA replication; positive regulation of Ras protein signal transduction; positive regulation of transcription, DNA-dependent; positive regulation of tyrosine phosphorylation of Stat5 protein

Disease: Microvascular Complications Of Diabetes, Susceptibility To, 2