Ephrin Type-B Receptor 1 (EPHB1) Active Protein | EPHB1 active protein

Recombinant Human Ephrin Type-B Receptor 1 (EPHB1), Partial

Cat. Num. AAA7115147

• Gene Names: EPHB1; ELK; NET; Hek6; EPHT2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ephrin Type-B Receptor 1 (EPHB1); Recombinant Human Ephrin Type-B Receptor 1 (EPHB1); Partial; Ephrin Type-B Receptor 1; ELK; EPH Tyrosine Kinase 2; EPH-Like Kinase 6; EK6; hEK6; Neuronally-Expressed EPH; Related Tyrosine Kinase; NET; Tyrosine-Protein Kinase Receptor EPH-2; EPHB1; EPHT2; HEK6; EPHB1 active protein

• Host: Mammalian Cell
• Specificity: Preferentially expressed in brain.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
• Sequence Positions: 564-984aa; Partial
• Sequence: SRKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQPLLDRSIPDFTAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGITLAGHQKKILNSIHSMRVQISQSPTAMA
• Sequence Length: 984

• Species: Human
• Tag: C-terminal 6xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to binding Human EFNB2 used funtional ELISA is less than 100 ug/ml.
• Subcellular Location: Cell Membrane, Single-Pass Type I Membrane Protein, Early Endosome Membrane, Cell Projection, Dendrite
• Protein Families: Protein Kinase Superfamily, Tyr protein Kinase Family, Ephrin Receptor Subfamily
• Classification: Other Recombinant Protein
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for EPHB1 active protein

Relevance: Ephrin Type-B Receptor 1 (EPHB1) is a single-pass type I membrane protein that belongs to the Ephrin-B family of receptor tyrosine kinases that is involved in embryonic nervous and vascular system development. EPHB1/EPHT2 contains two fibronectin type-III domains, one protein kinase domain and one SAM (sterile alpha motif) domain. EPHB1 could stimulate fibroblast motility on extracellular matrix in a kinase-dependent manner, which also correlated with its association with Grb7, an adaptor molecule implicated in the regulation of cell migration. It binds to ephrin-B1, ephrin-B2 and ephrin-B3. EPHB1 plays an important roles in diverse biological processes including nervous system development, angiogenesis, and neural synapsis formation and maturation and may be involved in cell-cell interactions in the nervous system.

Function: Receptor tyrosine kinase which binds promiscuously transmembrane ephrin-B family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Cognate/functional ephrin ligands for this receptor include EFNB1, EFNB2 and EFNB3. During nervous system development, regulates retinal axon guidance redirecting ipsilaterally ventrotemporal retinal ganglion cells axons at the optic chiasm midline. This probably requires repulsive interaction with EFNB2. In the adult nervous system together with EFNB3, regulates chemotaxis, proliferation and polarity of the hippocampus neural progenitors. In addition to its role in axon guidance plays also an important redundant role with other ephrin-B receptors in development and maturation of dendritic spines and synapse formation. May also regulate angiogenesis. More generally, may play a role in targeted cell migration and adhesion. Upon activation by EFNB1 and probably other ephrin-B ligands activates the MAPK/ERK and the JNK signaling cascades to regulate cell migration and adhesion respectively. Involved in the maintenance of the pool of satellite cells (muscle stem cells) by promoting their self-renewal and reducing their activation and differentiation (By similarity).

Product Categories/Family for EPHB1 active protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 4758284
• NCBI GeneID: 2047
• NCBI Accession #: NP_004432.1
• NCBI GenBank Nucleotide #: NM_004441.5
• UniProt Accession #: P54762
• Molecular Weight: 48.8 kDa
• NCBI Official Full Name: ephrin type-B receptor 1
• NCBI Official Synonym Full Names: EPH receptor B1
• NCBI Official Symbol: EPHB1
• NCBI Official Synonym Symbols: ELK; NET; Hek6; EPHT2
• NCBI Protein Information: ephrin type-B receptor 1
• UniProt Protein Name: Ephrin type-B receptor 1
• Protein Family: Ephrin type-B receptor
• UniProt Gene Name: EPHB1
• UniProt Synonym Gene Names: ELK; EPHT2; HEK6; NET; EK6; hEK6; NET
• UniProt Entry Name: EPHB1_HUMAN

NCBI Description

Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members. [provided by RefSeq, Jul 2008]

Uniprot Description

EphB1: a receptor tyrosine kinase of the Eph family. Receptor for members of the ephrin-B family: ephrin-B1, -B2 and -B3. The Eph receptor tyrosine kinase family, the largest in the tyrosine kinase group, has fourteen members. They bind membrane-anchored ligands, ephrins, at sites of cell-cell contact, regulating the repulsion and adhesion of cells that underlie the establishment, maintenance, and remodeling of patterns of cellular organization. Eph signals are particularly important in regulating cell adhesion and cell migration during development, axon guidance, homeostasis and disease. EphA receptors bind to GPI-anchored ephrin-A ligands, while EphB receptors bind to ephrin-B proteins that have a transmembrane and cytoplasmic domain. Interactions between EphB receptor kinases and ephrin-B proteins transduce signals bidirectionally, signaling to both interacting cell types. Eph receptors and ephrins also regulate the adhesion of endothelial cells and are required for the remodeling of blood vessels. The ligand-activated form of EphB1 interacts with GRB2, GRB10 and NCK through their respective SH2 domains. Four alternatively spliced isoforms are known.

Protein type: Protein kinase, tyrosine (receptor); Kinase, protein; Protein kinase, TK; Membrane protein, integral; EC 2.7.10.1; TK group; Eph family

Chromosomal Location of Human Ortholog: 3q21-q23

Cellular Component: early endosome membrane; integral to plasma membrane; axon; dendrite; extracellular region; plasma membrane; cytosol; lipid raft

Molecular Function: protein binding; transmembrane-ephrin receptor activity; axon guidance receptor activity; ATP binding

Biological Process: positive regulation of synaptogenesis; axon guidance; camera-type eye morphogenesis; peptidyl-tyrosine phosphorylation; neurogenesis; establishment of cell polarity; protein amino acid autophosphorylation; ephrin receptor signaling pathway; central nervous system projection neuron axonogenesis; angiogenesis; optic nerve morphogenesis; detection of temperature stimulus involved in sensory perception of pain; regulation of JNK cascade; cell-substrate adhesion; retinal ganglion cell axon guidance