Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Activin Receptor Type-1B (ACVR1B) Active Protein | ACVR1B active protein

Recombinant Human Activin Receptor Type-1B (ACVR1B), Partial

Gene Names
ACVR1B; ALK4; SKR2; ACTRIB; ACVRLK4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Activin Receptor Type-1B (ACVR1B); Recombinant Human Activin Receptor Type-1B (ACVR1B); Partial; Activin Receptor Type-1B; Activin Receptor Type IB; ACTR-IB; Activin Receptor-Like Kinase 4; ALK-4; Serine/Threonine-Protein Kinase Receptor R2; SKR2; ACVR1B; ACVRLK4; ALK4; ACVR1B active protein
Ordering
For Research Use Only!
Host
Mammalian Cell
Specificity
Expressed in many tissues, most strongly in kidney, pancreas, brain, lung, and liver.
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
Sequence Positions
24-126aa; Extracellular Domain
Sequence
SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE
Sequence Length
505
Species
Human
Tag
C-terminal 6xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to binding recombinant human TDGF1 used funtional ELISA is less than 50 ng/ml.
Subcellular Location
Cell Membrane, Single-Pass Type I Membrane Protein
Protein Families
Protein Kinase Superfamily, TKL Ser/Thr protein Kinase Family, TGFB Receptor Subfamily
Classification
Other Recombinant Protein
Pathway
TGF-beta Signaling Pathway
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for ACVR1B active protein
Relevance: Activin Receptor Type-1B (ACVR1B) is a single-pass type I membrane protein that belongs to the protein kinase superfamily. ACVR1B contains one GS domain and one protein kinase domain and is expressed in many tissues, most strongly in kidney, pancreas, brain, lung, and liver. ACVR1B acts as a transducer of activin or activin like ligands signals. Activin binds to either ACVR2A or ACVR2B and then forms a complex with ACVR1B, ACVR2A or ACVR2B activating ACVR1B through phosphorylation of its regulatory GS domain. They go on to recruit the R-SMADs, SMAD2 and SMAD3. ACVR1B also transducers signals of nodal, GDF-1, and Vg1. Mutations in ACVR1B are associated with pituitary tumors.

Function: Transmembrane serine/threonine kinase activin type-1 receptor forming an activin receptor complex with activin receptor type-2 (ACVR2A or ACVR2B). Transduces the activin signal from the cell surface to the cytoplasm and is thus regulating a many physiological and pathological processes including neuronal differentiation and neuronal survival, hair follicle development and cycling, FSH production by the pituitary gland, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Activin is also thought to have a paracrine or autocrine role in follicular development in the ovary. Within the receptor complex, type-2 receptors (ACVR2A and/or ACVR2B) act as a primary activin receptors whereas the type-1 receptors like ACVR1B act as downstream transducers of activin signals. Activin binds to type-2 receptor at the plasma membrane and activates its serine-threonine kinase. The activated receptor type-2 then phosphorylates and activates the type-1 receptor such as ACVR1B. Once activated, the type-1 receptor binds and phosphorylates the SMAD proteins SMAD2 and SMAD3, on serine residues of the C-terminal tail. Soon after their association with the activin receptor and subsequent phosphorylation, SMAD2 and SMAD3 are released into the cytoplasm where they interact with the common partner SMAD4. This SMAD complex translocates into the nucleus where it mediates activin-induced transcription. Inhibitory SMAD7, which is recruited to ACVR1B through FKBP1A, can prevent the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. Activin signal transduction is also antagonized by the binding to the receptor of inhibin-B via the IGSF1 inhibin coreceptor. ACVR1B also phosphorylates TDP2.
Product Categories/Family for ACVR1B active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
91
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12.46 kDa
NCBI Official Full Name
activin receptor type-1B isoform a
NCBI Official Synonym Full Names
activin A receptor type 1B
NCBI Official Symbol
ACVR1B
NCBI Official Synonym Symbols
ALK4; SKR2; ACTRIB; ACVRLK4
NCBI Protein Information
activin receptor type-1B
UniProt Protein Name
Activin receptor type-1B
Protein Family
UniProt Gene Name
ACVR1B
UniProt Synonym Gene Names
ACVRLK4; ALK4; ACTR-IB; ALK-4; SKR2
UniProt Entry Name
ACV1B_HUMAN

NCBI Description

This gene encodes an activin A type IB receptor. Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I and two type II receptors. This protein is a type I receptor which is essential for signaling. Mutations in this gene are associated with pituitary tumors. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Jun 2010]

Uniprot Description

ALK4: Transmembrane serine/threonine kinase activin type-1 receptor forming an activin receptor complex with activin receptor type-2 (ACVR2A or ACVR2B). Transduces the activin signal from the cell surface to the cytoplasm and is thus regulating a many physiological and pathological processes including neuronal differentiation and neuronal survival, hair follicle development and cycling, FSH production by the pituitary gland, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Activin is also thought to have a paracrine or autocrine role in follicular development in the ovary. Within the receptor complex, type-2 receptors (ACVR2A and/or ACVR2B) act as a primary activin receptors whereas the type-1 receptors like ACVR1B act as downstream transducers of activin signals. Activin binds to type-2 receptor at the plasma membrane and activates its serine- threonine kinase. The activated receptor type-2 then phosphorylates and activates the type-1 receptor such as ACVR1B. Once activated, the type-1 receptor binds and phosphorylates the SMAD proteins SMAD2 and SMAD3, on serine residues of the C- terminal tail. Soon after their association with the activin receptor and subsequent phosphorylation, SMAD2 and SMAD3 are released into the cytoplasm where they interact with the common partner SMAD4. This SMAD complex translocates into the nucleus where it mediates activin-induced transcription. Inhibitory SMAD7, which is recruited to ACVR1B through FKBP1A, can prevent the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. Activin signal transduction is also antagonized by the binding to the receptor of inhibin-B via the IGSF1 inhibin coreceptor. ACVR1B also phosphorylates TDP2. ACVRIB is abundantly expressed in systemic sclerosis patient fibroblasts and production of collagen is also induced by activin-A/INHBA. This suggests that the activin/ACRV1B signaling mechanism is involved in systemic sclerosis. Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Kinase, protein; Membrane protein, integral; EC 2.7.11.30; Protein kinase, TKL; Protein kinase, Ser/Thr (receptor); TKL group; STKR family; Type1 subfamily

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: cell surface; integral to plasma membrane; plasma membrane; activin receptor complex; receptor complex

Molecular Function: activin receptor activity; metal ion binding; transmembrane receptor protein serine/threonine kinase activity; transforming growth factor beta receptor activity; protein serine/threonine kinase activity; protein binding; activin receptor activity, type I; ubiquitin protein ligase binding; growth factor binding; activin binding; SMAD binding; ATP binding; receptor signaling protein serine/threonine kinase activity

Biological Process: development of primary female sexual characteristics; central nervous system development; in utero embryonic development; positive regulation of erythrocyte differentiation; protein amino acid autophosphorylation; peptidyl-threonine phosphorylation; activin receptor signaling pathway; signal transduction; protein amino acid phosphorylation; positive regulation of activin receptor signaling pathway; hair follicle development; regulation of transcription, DNA-dependent; transmembrane receptor protein serine/threonine kinase signaling pathway; positive regulation of transcription from RNA polymerase II promoter; negative regulation of cell growth; G1/S transition of mitotic cell cycle

Research Articles on ACVR1B

Similar Products

Product Notes

The ACVR1B acvr1b (Catalog #AAA7115133) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-126aa; Extracellular Domain. The amino acid sequence is listed below: SGPRGVQALL CACTSCLQAN YTCETDGACM VSIFNLDGME HHVRTCIPKV ELVPAGKPFY CLSSEDLRNT HCCYTDYCNR IDLRVPSGHL KEPEHPSMWG PVE. It is sometimes possible for the material contained within the vial of "Activin Receptor Type-1B (ACVR1B), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.