Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Uncharacterized protein C2orf47 homolog, mitochondrial Recombinant Protein | Maip1 recombinant protein

Recombinant Rat Uncharacterized protein C2orf47 homolog, mitochondrial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Uncharacterized protein C2orf47 homolog; mitochondrial; Recombinant Rat Uncharacterized protein C2orf47 homolog; Maip1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
97-291, full length protein
Sequence
STEEQPQQRQRTRMIILGFSNPINWVRTRIYAFLIWAYFDKEFSIAEFSEGAKQAFAYVSKLLSQCKFDLLEELVAKEVLQVLKEKVASLSDNHKNALAADIDDIVYTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSESLSGANVFQVKLGDQSVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE
Sequence Length
195
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,090 Da
NCBI Official Full Name
m-AAA protease-interacting protein 1, mitochondrial
NCBI Official Synonym Full Names
matrix AAA peptidase interacting protein 1
NCBI Official Symbol
Maip1
NCBI Protein Information
m-AAA protease-interacting protein 1, mitochondrial
UniProt Protein Name
m-AAA protease-interacting protein 1, mitochondrial
UniProt Gene Name
Maip1

Uniprot Description

Promotes sorting of SMDT1/EMRE in mitochondria by ensuring its maturation. Interacts with the transit peptide region of SMDT1/EMRE precursor protein in the mitochondrial matrix, leading to protect it against protein degradation by YME1L1, thereby ensuring SMDT1/EMRE maturation by the mitochondrial processing peptidase (PMPCA and PMPCB).

Similar Products

Product Notes

The Maip1 maip1 (Catalog #AAA1415433) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 97-291, full length protein. The amino acid sequence is listed below: STEEQPQQRQ RTRMIILGFS NPINWVRTRI YAFLIWAYFD KEFSIAEFSE GAKQAFAYVS KLLSQCKFDL LEELVAKEVL QVLKEKVASL SDNHKNALAA DIDDIVYTST GDISIYYDEK GRKFVNILMC FWYLTSANIP SESLSGANVF QVKLGDQSVE TKQLLSASYE FQREFTQGVK PDWTIARIEH SKLLE. It is sometimes possible for the material contained within the vial of "Uncharacterized protein C2orf47 homolog, mitochondrial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.